KEGG   Streptococcus pasteurianus: SGPB_0743Help
Entry
SGPB_0743         CDS       T01524                                 

Gene name
pdhC
Definition
(GenBank) pyruvate dehydrogenase E2 component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
stb  Streptococcus pasteurianus
Pathway
stb00010  Glycolysis / Gluconeogenesis
stb00020  Citrate cycle (TCA cycle)
stb00620  Pyruvate metabolism
stb01100  Metabolic pathways
stb01110  Biosynthesis of secondary metabolites
stb01120  Microbial metabolism in diverse environments
stb01130  Biosynthesis of antibiotics
stb01200  Carbon metabolism
Module
stb_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:stb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SGPB_0743 (pdhC)
   00020 Citrate cycle (TCA cycle)
    SGPB_0743 (pdhC)
   00620 Pyruvate metabolism
    SGPB_0743 (pdhC)
Enzymes [BR:stb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SGPB_0743 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: BAK29831
UniProt: F5X5Z1
Position
784214..785608
Genome map
AA seq 464 aa AA seqDB search
MANEIIMPKLGVDMQEGEILEWKKAEGDEVNEGDILLEIMSDKTNMEIEAEDSGVLLKIV
HPAGDVVAVTEIIGYIGAEGETLVDSVGEKHVEQSASAQEAKVQPLQASTAPAISQKTSE
TGKVRATPAARKLARERGIDLEKITGSGENGRIHKENVEQFSKIRVTPLARRIAKDKGVD
LETLVGTGVSGKITKEDVLASLGDVAPQKEQADVKVTPQAGALADVTAASDGVEVIKMSA
MRKAISKGMSHSYFTAPTFTLNYDIDMTNLIALRKQLIEPIMAKTGYKVTFTDLIGLAVI
KTLMKEEHRFLNASLINDAQDIELHHFVNLAIAVGLSEGLVVPVVHGADQMSLSDFVVAS
KDVIQKAQAGKLKAAEMSGSTFTITNLGMFGVKSFNPIINQPNSAILGISATIETPVVHD
GEVVIRPIMGMSLTIDHRLVDGMNGAKFMLDLKALLENPLELLI
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaatgaaattattatgccaaagcttggtgtggacatgcaagaaggggaaattctt
gaatggaaaaaagctgaaggtgatgaggtcaatgagggtgatattctgcttgaaatcatg
tctgataagaccaatatggaaattgaagctgaagattctggcgtgctgttaaaaattgtt
catccggcaggtgatgtcgtagctgttaccgaaattatcggctatatcggagcagagggt
gaaactcttgttgattctgtgggtgagaaacacgttgaacagtcagcatcagctcaggaa
gcgaaagttcaaccgttgcaagcaagcacagcgccagcgatttcccaaaagacgtctgag
actggaaaagtccgtgctacgcctgctgctagaaagttggcacgtgagcgtggtattgac
cttgaaaaaatcactggcagcggtgaaaatgggcggattcacaaggaaaatgtggaacaa
tttagtaagattcgtgtgacgccactggctcgtaggattgcaaaggacaaaggtgttgac
cttgagacactggtgggaacgggtgtttctggtaagattaccaaggaagatgttttagca
agtctaggtgatgttgcgccgcaaaaagaacaagcagatgtaaaagtgacaccgcaagca
ggagctttggctgatgttacggctgcaagtgacggagttgaagtcattaagatgtctgct
atgcgtaaggcaatttcaaagggaatgagccattcttactttacagcaccgacctttacg
cttaattatgatattgatatgacgaatctgattgccttgcgtaagcaactcattgagcca
attatggcaaagactggttacaaggtgacctttacggacttaattgggcttgctgtgatt
aagaccttgatgaaggaggaacaccgtttccttaatgcttctctgattaacgatgctcaa
gacatcgaactacatcattttgtcaatcttgcaatcgctgttgggctttctgaaggttta
gtggttcctgtggttcatggtgcagaccagatgagtttgtcagactttgtggtagcatca
aaagatgtgattcaaaaagcacaagctggtaaattgaaagcagctgaaatgtctggctca
actttcaccataacgaaccttgggatgtttggagtgaagtcgtttaatccgattattaat
caaccaaattcggcaattcttgggatttcagcaactattgaaacacccgtcgttcatgac
ggtgaagtggttattcgcccaattatgggaatgagtttgaccattgatcaccgattggtt
gacggaatgaatggtgcaaaattcatgctagatttaaaagcgcttcttgaaaatccgcta
gaattgctaatctaa

DBGET integrated database retrieval system