KEGG   Streptococcus pasteurianus: SGPB_0854Help
Entry
SGPB_0854         CDS       T01524                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
stb  Streptococcus pasteurianus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:stb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SGPB_0854 (pfkA)
   01230 Biosynthesis of amino acids
    SGPB_0854 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SGPB_0854 (pfkA)
   00030 Pentose phosphate pathway
    SGPB_0854 (pfkA)
   00051 Fructose and mannose metabolism
    SGPB_0854 (pfkA)
   00052 Galactose metabolism
    SGPB_0854 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    SGPB_0854 (pfkA)
Enzymes [BR:stb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SGPB_0854 (pfkA)
Protein phosphatases and associated proteins [BR:stb01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SGPB_0854 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
893799..894815
Genome map
AA seq 338 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAVRAVVRKAIKEGMEVFGINRGYAGMVEGDIFPLDAQSVSNT
LSHGGTFLQSARYPEFATLEGQLAGIEQLKKHGIEGVVVIGGDGSYHGAMRLTEHGFPAV
GIPGTIDNDIAGTDYTIGFDTAVNTAMEALDKIRDTSFSHKRTFVVEVMGRNAGDIALWS
GIAAGADQIIIPEEKYDIKDVVAKVKDGYENKGKERHLIVLAEGVMHAEKFAELMKEAGD
TSDLRATNLGHILRGGAPSPRDRVLASWMGAHAVELLLEGRGGLAVGIHNEELVESPILG
TKEEGALFSLAEDGSIIVNMPHKARLDFAKLNRDIAHL
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgctgttttaactagtggcggcgacgctcctggtatgaatgctgctgtt
cgtgcagttgttcgtaaagcaattaaagaaggaatggaagttttcggaatcaaccgtggc
tatgctggtatggttgaaggcgatatcttcccattggatgctcaaagtgtgtcaaatacc
ttgtcacatggtgggacattccttcaatctgctcgttatcctgagtttgcaactcttgaa
ggacaattagcaggtatcgaacaacttaaaaaacacggtattgaaggtgtcgttgttatc
ggtggtgatggttcttatcatggtgctatgcgcttgactgaacatggttttccagctgtc
ggtattccaggtacaattgataacgatatcgctggtacagattatactattggctttgac
acagctgttaacacagctatggaagctcttgataaaatccgtgatacatcattcagtcac
aaacgtactttcgttgtcgaagtaatgggacgtaacgctggtgatatcgctctttggtct
ggtattgctgcaggtgctgaccaaatcatcatccctgaagaaaaatacgacattaaagac
gttgttgcaaaagttaaagatggttatgaaaacaaaggtaaagaacgtcaccttatcgtt
cttgctgaaggtgttatgcatgccgaaaaattcgctgaattgatgaaagaagctggagat
actagtgaccttcgtgctacaaaccttggtcacatccttcgtggtggtgctccatcacct
cgtgatcgtgttcttgcttcctggatgggggcacacgccgttgaacttcttcttgaagga
cgcggtggacttgctgttggtatccacaacgaagaattggtagaaagcccaatccttgga
acaaaagaagaaggtgcattgttctcattggcagaagatggaagcattattgtcaacatg
cctcacaaagcacgccttgactttgctaaattaaaccgtgacattgctcacttatag

DBGET integrated database retrieval system