KEGG   Streptococcus pasteurianus: SGPB_1356Help
Entry
SGPB_1356         CDS       T01524                                 

Gene name
murE.1
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
stb  Streptococcus pasteurianus
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:stb00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:stb00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1413749..1415092
Genome map
AA seq 447 aa AA seqDB search
MKVNTLMGITAGKSAHFVLSKMGRGSTLPGKIALKFDKDILDTIAKDYEIVVVTGTNGKT
LTTALTVGILREAFGEIVTNPSGANMITGITSTFLTAKKAKSGKKIAVLEIDEASLPKIT
EYITPSLFVFTNIFRDQMDRYGEIYTTYQMILDGAAKAPTATILANGDSPLFNSTNVVNP
VKYYGFDTEKHTPELAHYNTEGILCPQCQQILKYKLNTYANLGDYVCDNCGFHRPKLDYA
LTELTKITNTTSEFVIDGQDYKINVGGLYNIYNALAAVSVAEFFGVAPEKIKAGFDKSRA
VFGRQETFKIGDKSCTLVLIKNPVGASQALDMIKLAPYPFTLSVLLNANYADGIDTSWIW
DANFEAVLDMDIPQAFAGGVRHSEIARRLRVTGYDENNITEAESLEDIMALIESQTTEHA
YILATYTAMLQFREILASRHAVGKEMN
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaaacacacttatgggaatcacggctgggaagtcagctcactttgtcctttca
aaaatgggacgtggctcaaccttgcctggaaaaatcgccctcaaattcgacaaagatatc
ttagacactatcgctaaagattatgaaatcgttgtggtaacaggaacaaacggtaaaact
ttgaccactgctcttacagttgggattttacgtgaagcttttggtgaaatcgtcacaaat
ccaagcggtgccaatatgattactgggattacttcaactttcttgacagccaaaaaagcc
aaatctggtaaaaaaattgccgtgcttgaaatcgacgaagctagtctgccaaaaatcaca
gaatacatcacaccaagtctctttgtattcaccaatattttccgtgaccaaatggaccgt
tacggtgaaatttacaccacttaccaaatgattttagacggtgctgccaaagctccaaca
gcaacaatcttagccaacggagacagcccacttttcaattctacaaacgtggtaaatcct
gttaaatattatggctttgacactgaaaaacacactccagaactcgcacactataatacc
gaaggaattttgtgtccacaatgtcagcaaattctaaaatacaaattgaacacctatgca
aaccttggtgattatgtctgtgacaattgtggtttccaccgtccaaaactcgattatgcc
ttgacagaattgacgaaaatcaccaatacaacttctgaatttgtcattgacggtcaagat
tacaaaatcaacgtcggtggtctctataacatttataacgctcttgctgcggtatctgtt
gctgaatttttcggagttgctcctgaaaaaattaaagctggttttgataagagtcgcgcc
gtctttggacgccaagaaacctttaaaatcggtgataaatcttgtactttggttctcatt
aaaaacccagttggcgctagtcaagcacttgatatgattaaattagccccttatccattt
acactttctgtcctactcaatgccaattacgctgacggaattgataccagttggatttgg
gatgctaacttcgaggctgttttagatatggatattcctcaagcatttgcaggcggtgtt
cgtcattctgaaattgctcgtcgtttgcgtgtgacaggctacgatgaaaacaacatcacc
gaagccgaaagtctcgaggatattatggcattaattgaatcacaaacaactgagcacgcc
tatatccttgcaacttataccgccatgttacaattccgagaaattctagctagtcgccat
gccgttggaaaggagatgaattaa

DBGET integrated database retrieval system