KEGG   Streptococcus pasteurianus: SGPB_1370Help
Entry
SGPB_1370         CDS       T01524                                 

Gene name
hisD
Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
stb  Streptococcus pasteurianus
Pathway
stb00340  Histidine metabolism
stb01100  Metabolic pathways
stb01110  Biosynthesis of secondary metabolites
stb01230  Biosynthesis of amino acids
Module
stb_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:stb00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    SGPB_1370 (hisD)
Enzymes [BR:stb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     SGPB_1370 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh Imm21
Motif
Other DBs
NCBI-ProteinID: BAK30410
UniProt: F5X2A1
Position
complement(1427612..1428889)
Genome map
AA seq 425 aa AA seqDB search
MKRLTGTTEEISKILYQEQLELSKENLDVDDAVRQILEDVKENGDNALKAYSEKFDKITL
DNFEVGKELVDQAFEEIDAEVLEALKNAKANIESYHKQQLEKGFEDQPTEGVVRGQLIRP
IERVGVYVPGGTAAYPSSVLMNVIPAKIAGVKEIIMITPPQAHFEPAILVAASLAGVDKI
YQIGGAQGVAALAYGTETIPRVDKITGPGNIFVATAKKLVYGIVGIDMIAGPSEIGVIAD
DTANPKYVAADLLSQAEHDVRARAILVTNSAALADAVEKEIEEQLKTLPREEIARASVEN
NGRIIIADSVEAMFELMNQVAPEHLEIAMDNAYDYLDAIENAGSVFLGHFTSEPIGDYYA
GANHILPTTSTSRFSSALGVHDFVKRIQYMQYSKIAVNAASHDITTLAYAEGLQAHARAI
EVRHD
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtttaacaggaacgacagaagaaatttcaaaaattctctaccaagaacaatta
gaattaagcaaagaaaatcttgatgttgatgatgcggttcgtcaaattttagaagatgtc
aaagaaaatggtgataacgcacttaaagcctattccgaaaaatttgacaagattacgctt
gataattttgaagttggtaaggagttggttgaccaagcgtttgaggaaattgatgccgag
gttttggaagctctcaaaaatgccaaagcgaatattgaaagttatcacaagcaacagttg
gaaaaaggatttgaggaccaaccaactgaaggcgttgttcgtgggcaattgattcgtccg
attgagcgtgttggggtttatgtcccaggtggaactgctgcttatccgtcatctgttttg
atgaatgtcattccagctaagattgctggtgttaaagaaattatcatgattacaccgcca
caagcgcatttcgaacctgcgattttggtggctgcttcgttagctggtgttgataagatt
tatcaaattggtggggctcagggtgttgctgctttggcatatggtacagaaacaattcct
cgtgttgataagattactggaccaggaaatatttttgttgcgacagctaaaaaactcgtt
tacggtattgttggtattgacatgattgcaggtccgtctgaaattggtgtgatcgcagat
gacacagccaatccaaaatacgttgcagcagatttgctctcacaagctgagcatgatgtg
cgtgcgcgtgcgattttggtgacaaattcagcagcgttagcggatgcggttgaaaaggaa
atcgaagaacaacttaaaaccttgccacgtgaagaaattgcacgtgcttctgttgaaaat
aatggtcgtatcatcattgcagattctgttgaggcaatgtttgaattgatgaaccaagtg
gcgccagaacatttggaaattgctatggataatgcttatgattatcttgatgcgattgaa
aatgcgggttctgttttccttgggcatttcacgagtgaaccaatcggtgattattacgca
ggggcaaatcatattttgccaacaactagcacaagccgtttctcatcagcgctaggtgtg
catgattttgtcaaacgtatccagtatatgcaatattcaaaaattgctgtgaatgcagct
agtcacgatattacaacacttgcttatgctgaaggattacaagctcatgctagagctatt
gaggtgcgtcatgactaa

DBGET integrated database retrieval system