KEGG   Streptococcus pasteurianus: SGPB_1411Help
Entry
SGPB_1411         CDS       T01524                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
stb  Streptococcus pasteurianus
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:stb00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:stb00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1475945..1476430
Genome map
AA seq 161 aa AA seqDB search
MTNLYDFTVKAQDSSDVQLSKYQGKILLIVNTATGCGLTPQYEGLQKLYDTYHDKGFEIL
DFPCNQFLNQAPGNTDEINTFCTLNYQTTFPRFAKIKVNGKEAAPLYDWLKSEQKGPLGK
RIEWNFAKFLIDQNGNVIKRFSSKTEPETIVTEIESLINDK
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgactaatctttatgactttactgtcaaagcccaagacagctccgatgtccaattgtca
aaataccaaggtaaaatcctactcattgtcaatacggcaacaggttgtggcttaacccca
caatacgaaggactacaaaagctttacgacacttaccatgacaaaggatttgaaatttta
gattttccttgtaatcaatttttaaatcaagcgccaggaaacaccgacgaaatcaatacc
ttttgcaccttgaattaccagacaacttttcctcgctttgcgaaaattaaagtcaacggt
aaagaagccgccccactctatgattggctaaaaagtgaacaaaagggaccgcttggcaaa
cgtattgaatggaactttgcaaaatttcttatcgaccaaaatggcaatgtcatcaaacgt
ttttcatcaaaaacagaacctgaaacaattgttacagaaattgaaagccttatcaatgac
aaatag

DBGET integrated database retrieval system