KEGG   Streptococcus pasteurianus: SGPB_1644Help
Entry
SGPB_1644         CDS       T01524                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
stb  Streptococcus pasteurianus
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:stb01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:stb00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1702824..1704206
Genome map
AA seq 460 aa AA seqDB search
MVVSDSNQLQKFENDDVAQYYFEILRQLIAKKSIFAQQIGLAEVANYLGDIFTEAGAEVT
IDDTCTAPFVLARFKSNRPDAQTIIFYNHYDTVPADDDQPWSSNPFELTVRDGYMYGRGV
DDDKGHITARLTAVQKYRREFGDFPVNIIFIMEGSEESASVGLETYLEKYADELRGADLL
VWEQGISNAKGQIEISGGTKGIVTFDMIVDSAKVDIHSKFGAVIESASWYLINAIASLRD
ETGRILVDGIYDQVIEPSERELSLILEHANLDADNLKTLYGLNLPMLTRDKEKLVRTLFF
EPAITIEGISTGYQGQGVKTILPAKAQAKMEVRLVPGLVPRDVLQKIEQHLQQYGFEQVE
LVYTLGEKAYRSDMSAPAILNVIEIAKVFSPNGVSVLPTTAGTGPMHQFFEALEVPIASF
GIGNPDSRDHAGDENVNLADYYTHIEMIEELIKSYDKTDY
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atggtagtaagtgatagtaatcagttgcagaagtttgaaaatgatgacgttgctcaatat
tattttgagattttacgtcagttaattgctaaaaaatcgatttttgcacagcaaattggg
ttagcagaagtagcaaattatctaggcgatattttcactgaagctggtgctgaggtgacg
attgacgatacttgtacggctccgtttgttttagcacgttttaagagcaatagacctgat
gctcagacgattattttttacaaccattatgatactgtgccagctgatgatgaccagcct
tggtcgtcaaatccgtttgaattaaccgtccgtgatggctacatgtatggacgtggtgtt
gatgacgataaagggcatatcacagcacgcttgacagccgttcagaagtatcgccgtgag
tttggagattttccagttaacattatatttattatggaaggttcggaagaatcagcttct
gtgggtcttgaaacctatcttgaaaaatacgctgatgagctccgtggcgcggatttattg
gtgtgggagcaaggtatttcaaatgccaaaggtcagattgaaatttctggtggaacaaaa
ggtattgtcacctttgatatgattgttgattctgctaaggttgatattcattcgaaattt
ggtgcggtcattgagtcagcatcatggtatttgattaatgcaattgctagccttcgtgat
gaaactggtcgcattttggttgacgggatttatgaccaagtcattgagccaagtgagcgt
gagttgtcacttatactagaacatgccaatcttgatgctgataacctaaaaacactatat
ggtttgaatttgccgatgttgacaagggataaggaaaagttagttcgaacgcttttcttt
gaaccagctatcacgattgaaggaatttcaacaggatatcaagggcaaggtgtcaaaaca
attctaccagctaaagctcaggctaaaatggaagttcgtttggttcctgggcttgtgcca
agagatgttcttcagaagattgaacaacatttgcaacaatatggctttgagcaggtggag
ttggtttacacattgggtgaaaaggcttatcgtagtgacatgtctgccccagctattctc
aatgtgattgagattgcaaaggtattttcaccaaatggtgtttcagttttacctacgact
gctggtactggaccaatgcaccaattctttgaagcattagaagttccgattgcttctttt
ggtattggcaatccagatagccgtgaccatgctggagatgaaaatgttaatttggcggat
tattacacccacattgaaatgattgaggagttgattaagagttatgacaaaaccgattat
taa

DBGET integrated database retrieval system