KEGG   Streptococcus pasteurianus: SGPB_1775Help
Entry
SGPB_1775         CDS       T01524                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
stb  Streptococcus pasteurianus
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:stb03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1835375..1837855
Genome map
AA seq 826 aa AA seqDB search
MEYFFSGTIDRIIFENASNFFKIVLLEIEDTDSDFDDFEVIVTGTIADIIEGENYTFWGE
LTQHPKYGEQLRVTRYERSKPTSSGLIKYFSSDHFKGIGKKTAEKIVQLYGDNTIDKILE
DSSKLDSISGLSKENKDNFLTKLKLNYGTELILAKLAEYGLTNRVAFDIFNQYKEDSLDI
IQENPYQLVEDIQGIGFKIADQLAEQLGIEADAPQRFRAALVHSLFETSIERGDTYVEAR
DLLENAITTLEEARQVELDPAAVAKELSTLIAEDKVQNVGTKIFDNTLFYAESGIKKHLT
RILDTPLDQKFSDDDLQEEIADVEEAFGISYDDVQKNAIKEALKSKVFILTGGPGTGKTT
VINGLIAAYADLHQIDLEKKEIPIILAAPTGRAARRMNELTGLPSATIHRHLGLNGDNDY
QAIDDYLDCDLIIIDEFSMVDTWLANQLFSSISSNTQVIIVGDSDQLPSVGPGQVLADLL
KIEALPQLALTKIFRQSEDSTIVTLANQMRLGKLPADFTQKKADRSYFEASAQYIPEMIP
KIVSAAVKSGIDPQEIQILAPMYRGAAGINRLNTIIQDLLNPLKDQLSFALGEMNFRKGD
KVLHLINDAELNVFNGDIGYITDLIPAKYTESKQDELYMSFDGTEVTYPRNEWHKITLAY
AMSIHKSQGSEFQVVILPITRQSHRLLQRNLIYTAITRSKSKLVMLGEIAAFDYAIKNEG
AKRNTYLVQRFTSSAQEEESIDLQTEISQQTSPKTDNEAEKITSPTSPKTNISKEENIQL
TLDIAENEQTQTEQEPKIYRLTEENLAFINPMIGITQADIEQFFKK
NT seq 2481 nt NT seq  +upstreamnt  +downstreamnt
atggaatacttcttttctggcacaattgaccgtattatttttgaaaatgccagtaatttc
tttaaaattgtattactcgaaattgaggatactgattcagactttgatgattttgaagtc
attgttactggaacaattgctgatattatcgagggagaaaattatacgttttggggtgaa
ttaacgcaacacccaaaatatggcgaacagctcagagtcacacgttacgagcgcagcaaa
ccaacttcttctggtctaattaaatatttttcaagcgaccatttcaaaggaattggtaaa
aaaactgctgaaaaaattgtgcagctttacggtgacaataccattgataaaatcctagaa
gactctagtaaattagacagtatttctgggctttctaaggaaaataaagacaacttttta
accaaactcaagcttaattatggtacagagctcattttagccaagttggcagagtatggc
ttgactaatcgtgttgcctttgacatttttaatcaatacaaggaagacagtcttgatatt
atccaagaaaatccttatcaattagtcgaagacattcaagggattggttttaaaatcgct
gaccaactcgctgaacaattaggaatcgaagcggacgctcctcaacgttttcgtgccgct
ctcgtacacagtctttttgaaacttctattgagcgaggagatacttacgtcgaagcgcgt
gatttgcttgaaaatgccattactacccttgaagaagctagacaagttgagttagacccc
gcagccgttgccaaagaattatcaacacttattgctgaagataaggtgcaaaatgtcggt
accaaaatttttgacaatactcttttctatgctgaatcaggtatcaaaaaacacttgaca
cgtattcttgatacaccactcgaccaaaagttttcagatgatgacttgcaagaagaaatc
gctgacgttgaggaagctttcggcatttcttacgacgatgtacaaaaaaatgctatcaaa
gaagcgctcaagagcaaggtgtttattttgactggtggtcctgggacgggaaaaacgact
gttatcaacggtttgattgctgcctacgcagaccttcatcaaattgaccttgagaaaaaa
gagattcctatcatcttagcagcgccaacaggacgtgctgcccgccgtatgaatgaatta
acaggcttgccaagtgcgactattcaccgccatttggggttaaatggtgataacgactac
caagctattgatgattatctcgactgtgacttgattatcattgatgaattttcgatggtt
gatacttggcttgccaatcaactctttagttccatttcgtccaatactcaagtcatcatc
gttggagatagtgaccaattgccgtctgtcggtcctgggcaagtattagctgatttatta
aaaattgaagctcttcctcaactagcattgactaaaatctttagacaatcagaagattca
accattgttacacttgctaatcagatgagacttggaaaattaccagctgacttcacacaa
aagaaagctgaccgttcttattttgaagcaagtgcacaatatatcccagaaatgattcct
aaaattgtcagcgcagctgttaagagtggaatcgacccacaagaaatacaaattcttgcc
ccaatgtaccgtggcgcagctgggattaatcgacttaataccattattcaggatttactt
aacccgcttaaagatcaactctcgtttgccttgggtgagatgaatttccgtaagggtgac
aaagttctccacctcatcaacgatgctgaactcaatgttttcaatggtgatatcggctat
attacagaccttattcctgctaaatataccgaatccaaacaagacgagctttacatgtct
tttgacggcactgaagttacctaccctcgtaatgaatggcataaaatcacccttgcttac
gccatgtcaatccacaaatcacaagggagcgaatttcaggttgtcattttgccgatcact
cgccaaagtcaccgactcttacaacgtaacctcatttacacagctatcacccgctctaag
agtaaattagtgatgttaggggaaattgccgcctttgattacgccataaaaaacgaaggc
gctaagcgcaacacctatcttgttcaacgctttacaagctccgctcaagaagaagaaagt
attgatttacaaactgaaatttctcaacaaacatcacctaaaacagataatgaagctgag
aaaatcacctctccaacttctcccaaaacaaatatttctaaagaagaaaacattcaactg
acactagatattgccgaaaatgagcaaacacaaacagagcaagaaccaaaaatctatcgc
ttgacagaagaaaacttggcatttatcaacccaatgattggcattacccaagccgacatt
gaacaattttttaagaaataa

DBGET integrated database retrieval system