KEGG   Streptococcus pasteurianus: SGPB_1781Help
Entry
SGPB_1781         CDS       T01524                                 

Gene name
bglA.8
Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
stb  Streptococcus pasteurianus
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:stb00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1843363..1844823)
Genome map
AA seq 486 aa AA seqDB search
MIKEVRHGFPKDFMWGGAIAANQCEGAWDVDGKGMSTADIHPYLPNLNRKELDFNHLDSQ
IFEKFKGNDDYYYPNHKGVEFFYRYKEYFALLHEMGFTCFRMSIAWTRIFPTGEEDKPNE
AGLKHYHDVFQELKKYGIEPIVTMSHYEMPLHLVEKYNGWSSREVIDLFVKYCGTVLKEY
KDEVKYWIIINQINLIQYECFGSLGILKDKTDNYLEAQFQGIHHQFVASAKVVKLAKRIN
PNFKMGTMLADCIINPYTCNPKDIELALRRNRMQYFFGDVQILGEYPQFVIQYFDKNDLN
IKIEEGDLELIAKYTVDFLCVSYYYSRCVDANKNGMDADDTVDNPYLKANEWGWAINPQG
LYCTMSNYHDRYHVPMMIGENGFGYVDVLEEGNKVHDTYRIDYLGKHIKALQNAIEDGCD
IFAYCSWAPFDIISAGTAEISKRYGYIYVDYDDYGNGSGNLYKKDSFYWYKEVIETNGKS
LENIEL
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgattaaagaagtgagacatggttttccaaaagatttcatgtggggtggggctattgcc
gctaatcaatgtgaaggtgcttgggatgtagatggtaaagggatgagtacggccgatatt
catccatacttaccaaacttaaatcgcaaagaattggattttaatcacttggatagtcag
atttttgaaaaatttaaaggtaatgatgattattattatcctaaccataaaggagtcgag
ttcttttataggtataaagaatactttgctttgttacatgaaatggggttcacatgtttc
cgtatgtcaattgcttggactcgcatttttcctacaggtgaagaagataaacctaatgaa
gcaggtttaaaacattatcatgatgtttttcaagagttaaagaaatatggtattgaacca
atcgtgacaatgagccactatgaaatgccattacatttagttgaaaaatacaatgggtgg
agttccagagaagttattgatttatttgtaaaatattgtggaacagtgttaaaagaatat
aaagacgaagtcaaatactggattattattaaccaaattaatttaattcaatatgaatgc
tttggttcacttggtattttaaaagataaaaccgataactatttagaagcacaatttcaa
ggtattcatcaccaatttgtagcttcggctaaagtagttaaattagctaaaaggattaat
cctaattttaaaatggggacaatgctagcagactgtatcattaatccatatacatgcaat
cctaaggatattgaattagcattacgtcgtaatcgtatgcaatacttctttggagatgtt
caaatcttaggagaatatccacaatttgttattcaatattttgataaaaatgatctcaat
atcaaaattgaagaaggggatttagaattaattgcaaaatatacagtagattttctatgt
gtaagttactattattctcgctgcgttgatgcaaataaaaatggtatggatgccgatgat
acagtagacaatccatatttaaaagcaaatgagtggggctgggctattaatcctcaaggt
ttatattgcacaatgtcaaactatcatgatcgttaccatgtaccaatgatgattggtgaa
aatggtttcggatatgttgatgtattagaagaggggaataaagtgcacgatacatatcgt
attgattacttaggtaagcatattaaagctcttcaaaatgctattgaagatgggtgtgat
atttttgcttattgctcatgggcgccatttgatattattagtgccggtacggcagaaatt
tctaaacgttacggatatatttatgtggattacgatgattacggcaacggttctggtaat
ttatataaaaaagatagtttttattggtataaagaggttattgagactaatggtaagagt
ttagaaaatatcgagctataa

DBGET integrated database retrieval system