KEGG   Streptococcus pasteurianus: SGPB_1874Help
Entry
SGPB_1874         CDS       T01524                                 

Gene name
gltX
Definition
nondiscriminating glutamyl-tRNA synthetase (EC:6.1.1.24)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
stb  Streptococcus pasteurianus
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:stb00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1937255..1938739)
Genome map
AA seq 494 aa AA seqDB search
MIEIQQETKMPKKIRVRYAPSPTGLLHIGNARTALFNYLYARHHGGDFVIRIEDTDRKRH
VEDGERSQLENLKWLGMDWDESPQTHEKYRQSERLDIYQKYIDQLLAEGKAYKSYVTEEE
LAAERERQEAAGETPRYINEFLGMSEDEKAAYIAEREAKGIVPTVRLAVNESGIYKWHDI
VKGDIEFEGGNIGGDWVIQKKDGYPTYNFAVVVDDHLMEISHVIRGDDHIANTPKQLMVY
EALGWEAPEFGHMTLIINSETGKKLSKRDTNTLQFIEDYRKKGYMPEAVFNFIALLGWNP
GGEDEIFSREELIKLFDENRLSKSPAAFDQKKMDWMSNEYIKNADFDTIFAMAKPFLEEA
GRLTDKAEKLVELYKPQMKSVDEIIPLTDLFFEDFPELTDAEKEFMAGETVPIVLEAFKA
KLEAMSDEDFKSENIFPQIKAVQKETGIKGKNLFMPIRIAVSGEMHGPELPDTIYLLGRE
KSIEHIENMLNSLK
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgattgaaattcaacaggagacgaaaatgcctaagaaaattcgcgtgcgttatgcacca
agtccaacaggacttttacacatcggaaatgcgcgtactgcgctctttaattatctttat
gctcgtcaccatggtggtgattttgttattcgtatcgaagatactgaccgtaaacgtcat
gtcgaagacggtgaacgttcacaattggaaaaccttaaatggttgggaatggattgggat
gaaagcccacaaactcatgaaaaatatcgccaatcagaacgtttggacatttaccaaaaa
tacattgaccaattgttggcagaaggtaaagcttacaaatcatacgttactgaagaagaa
ttagctgcagaacgtgaacgccaagaagctgctggtgaaacacctcgttatatcaacgaa
ttccttggtatgtcagaagacgaaaaagctgcttatatcgcagaacgtgaagctaaagga
atcgttccaactgttcgtttggctgttaacgaatcaggcatttacaaatggcatgatatc
gttaaaggcgacatcgaatttgaaggtggtaacatcggtggtgactgggttatccagaaa
aaagatggttacccaacatacaacttcgccgttgttgttgatgaccatttgatggaaatt
tctcatgttatccgtggggatgaccatatcgcaaacacaccaaaacaattgatggtttac
gaagcacttggttgggaagcaccagaattcggtcacatgacattgattatcaactctgaa
actggtaaaaaattgtcaaaacgtgatacaaatacccttcaatttattgaagactaccgt
aaaaaaggttacatgccagaagcagtctttaactttatcgctcttcttggttggaatcct
ggtggtgaagacgaaatcttctcacgtgaagaattaatcaaactctttgatgaaaatcgt
ttgagcaaatctccagctgcctttgaccaaaagaaaatggactggatgagcaacgaatac
atcaagaatgctgattttgatacaatctttgcaatggcgaaaccattcttggaagaagct
ggtcgtttgactgacaaagctgaaaaattggttgaactttataaaccacaaatgaaatct
gttgacgaaatcattccattaacagatttgttctttgaagatttcccagaattaacagat
gctgaaaaagaattcatggctggtgaaacagttccaatagttcttgaagctttcaaagct
aaacttgaagcgatgagtgacgaagatttcaaatcagaaaatatcttcccacaaatcaaa
gccgttcaaaaagaaacaggtatcaaaggtaaaaacctctttatgccaattcgtatcgct
gtttcaggtgaaatgcacggtccagaacttccagatactatctaccttcttggtcgtgaa
aaatcaattgaacacatcgaaaatatgcttaacagcttgaaatga

DBGET integrated database retrieval system