KEGG   Streptococcus pasteurianus: SGPB_1885Help
Entry
SGPB_1885         CDS       T01524                                 

Gene name
galU
Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
stb  Streptococcus pasteurianus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:stb00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SGPB_1885 (galU)
   00052 Galactose metabolism
    SGPB_1885 (galU)
   00500 Starch and sucrose metabolism
    SGPB_1885 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    SGPB_1885 (galU)
Enzymes [BR:stb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SGPB_1885 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1947188..1948102
Genome map
AA seq 304 aa AA seqDB search
MRKVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEDILVVTGKS
KRSIEDHFDSNFELEYNLEHKGKTDLLKLVNDTTAINLHFIRQSHPRGLGDAVLQAKAFV
GNEPFVVMLGDDLMDINNNNAVPLTKQLINDYETTHASTIAVMPVPHEEVSSYGVIAPQG
EGIDGLYSVETFVEKPAPEDAPSDLAIIGRYLLTPEIFNILETQEPGAGNEIQLTDAIDT
LNKTQRVFARQFNGDRYDVGDKFGFMKTSIDYALQHPQIKDSMKQYLIDLGKELEADSKR
EETK
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaagttagaaaagccgtcattcccgctgctggtcttggaacacgcttcttgcca
gcaactaaagcactcgctaaagagatgcttccaattgttgataaaccaaccattcaattt
atcgtcgaagaagccttgaaatcaggtatcgaagacattttggttgttactgggaaatca
aaacgttcaatcgaagaccacttcgattcaaattttgaattagaatacaatttggaacat
aaagggaaaactgaccttctcaaacttgtgaatgatacaacagctatcaatcttcacttt
atccgccaaagtcatccacgcggattgggagatgctgttctgcaagccaaagcttttgtt
ggtaatgaaccttttgtcgttatgcttggtgacgaccttatggacatcaataataacaac
gctgtgccattgacaaaacaacttatcaatgactacgaaactacacatgcatcaactatc
gctgttatgcctgtaccacacgaagaagtatcatcttacggtgttattgctcctcaagga
gaaggcattgacggactttatagcgttgaaacatttgttgaaaaaccagcccctgaagat
gcaccaagtgaccttgcaatcatcggccgttatcttcttactccagaaatcttcaatatc
cttgaaacacaagaacctggagctggtaatgaaattcaattgacagatgctattgatacc
cttaacaaaacgcaacgtgttttcgcccgccaatttaacggtgaccgctatgatgtcggt
gacaaatttggctttatgaaaacttctattgactatgcccttcaacaccctcaaatcaaa
gatagcatgaaacaatatcttatcgatttaggtaaagaattagaagctgattcaaaaaga
gaagaaactaaataa

DBGET integrated database retrieval system