KEGG   Streptococcus thermophilus CNRZ1066: str0921Help
Entry
str0921           CDS       T00212                                 

Gene name
speB
Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
stc  Streptococcus thermophilus CNRZ1066
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stc00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    str0921 (speB)
Enzymes [BR:stc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     str0921 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
843873..844616
Genome map
AA seq 247 aa AA seqDB search
MKILSIIYDGGSRIPGARFAPTKYYQEAMLYDRKDSDIITINLGNQDLFSIDLESLSRTI
AESKVQIALGGDHSVTYLLAKATVREGAYLIVLDAHLDYFKDFESVVKNWNFLSFLTDIF
EKIIIIGERNFEFPSSFDNKIIILSMEEYWLNKSRVLKKLDSYIDESKDIYLSIDIDVLD
PSVFDSVSYPIIGGFQMNDFLGIISKILCSDKVYFCDIVEYNPMVGSDNAHIFYQMIQFV
KSKLRRI
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatattatctattatttatgatggtggaagtagaattccaggagcgagatttgct
cccacaaaatattatcaagaagcgatgttatatgataggaaagattctgatataattaca
attaatttaggtaatcaagatttattttctattgatttagaaagtctaagtcgaactatt
gctgaatctaaagttcagattgctttaggaggagatcattcagttacttatctattagca
aaggccactgttcgagagggagcatatttaattgttttagatgctcatttagattacttc
aaagactttgaaagtgttgtaaaaaattggaattttttaagttttttaaccgatattttt
gaaaaaataattatcattggggaaaggaattttgagtttcctagttcatttgataataaa
ataatcatcctctcaatggaggagtattggttaaataagagtagagttttgaaaaagtta
gatagttatattgatgagtcaaaagatatttacttatcaatagacattgatgttttggat
ccatctgtttttgattcagtatcatatcctattattggaggatttcaaatgaacgatttt
cttggaataatttccaaaattttatgttctgataaggtatatttttgtgatatagttgag
tacaatccgatggttggaagtgataatgctcacattttttaccaaatgattcaatttgtt
aaatcaaaattaaggaggatatag

DBGET integrated database retrieval system