KEGG   Streptococcus thermophilus CNRZ1066: str1013Help
Entry
str1013           CDS       T00212                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
stc  Streptococcus thermophilus CNRZ1066
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    str1013 (malQ)
Enzymes [BR:stc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     str1013 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(914394..915893)
Genome map
AA seq 499 aa AA seqDB search
MNIRASGVLMHITSLPGDYGIGSFGQAAYDFVDFLKETKQTYWQILPLTTTSYGDSPYQS
FSAIAGNTHFIDLDFLIRDGFLTEADVEGSDFGSDPEFIDYAKVYEARRPLLEKAVKAIL
ADENEAKKFETFKAENANWLADYADFMAIKEYFGNKALQDWDDKKVIKRDEATLEKLRKE
LTGVITYHQVVQYLFFSQWAELKSYANKNGIQIIGDMPIYVSADSVEVWTQPHLFKLDAE
CKPRYIAGVPPDNFSPTGQLWGNPIYDWDKHKAENYAWWVFRIQESFKLFDCLRIDHFKG
FSDFWEIPAGDETAENGKWVPGPGYDLFKVVKEELGDLKIIAEDLGNIDDKTRKLLADCG
YPGMKILHFGFYDTTGNSIYVPHAYTQHSVAYTGTHDNEVTNGWYNNLTQEQRDYTDAYI
NRRQGEPITRALLRTLFATVSNTAIATMQDILDKNENSRKNIPNTVGGNWRWRMLPGEIT
VDKKEFLTDITERYNRGNK
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaacatacgagcaagcggtgttttaatgcacatcacatcacttccaggtgactacgga
atcggatctttcggtcaagcagcctacgactttgttgatttcttgaaagaaacaaagcaa
acatactggcaaattttgccattgactactacaagttatggagattcaccttaccaatca
ttctcagcaatagcgggaaatactcactttatcgatttggatttccttattcgtgacgga
ttcctgactgaagcagatgttgaaggttctgattttggttcagatccagagtttatcgac
tacgctaaagtttacgaagcacgacgcccacttcttgaaaaagcagtcaaagcaatcttg
gcagatgaaaacgaagctaagaagtttgaaactttcaaagctgaaaatgctaactggttg
gcagattatgctgacttcatggctatcaaagaatactttggtaacaaagcccttcaagat
tgggatgataaaaaagtgattaaacgtgatgaagcaactcttgaaaagcttcgcaaagaa
cttactggtgttatcacataccatcaagttgtgcaatacctcttctttagccaatgggca
gagttgaaatcctatgctaataagaacggtattcaaattattggtgatatgccaatctac
gtttcagctgatagtgtggaagtctggactcaaccacaccttttcaaattagatgctgaa
tgtaagccacgttacattgccggagttccaccagataacttctcaccaacaggacaactt
tgggggaatccaatttatgattgggataaacacaaagcagaaaactatgcttggtgggtc
ttccgtattcaagaatcattcaaactttttgattgcttgcgtatcgaccacttcaaaggt
ttctctgatttctgggaaattcctgctggagatgaaactgctgaaaatggtaaatgggtt
ccaggacctggttatgacctcttcaaagtggttaaagaagagttgggtgatcttaagatt
attgccgaagaccttggtaatattgatgataagacacgtaaacttcttgcagactgtggt
tacccaggaatgaagattcttcactttggtttctatgataccactggtaacagcatttat
gttccacacgcatacacacaacactcagtggcttacactggtacacatgataatgaagtt
actaatggttggtataataacttgacacaagagcaacgtgattacactgatgcttatatc
aaccgtcgtcaaggtgaaccaatcacacgtgcccttcttcgcacactcttcgcaacagta
agtaacacagctattgcgactatgcaagatattcttgataaaaatgaaaatagccgtaaa
aacatccctaacacagttggaggaaactggagatggcgtatgcttccaggtgaaatcacc
gttgataagaaagaatttctgactgatattacagaaaggtataatcgaggaaataaataa

DBGET integrated database retrieval system