KEGG   Streptococcus thermophilus CNRZ1066: str1065Help
Entry
str1065           CDS       T00212                                 

Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
stc  Streptococcus thermophilus CNRZ1066
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:stc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    str1065
Enzymes [BR:stc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     str1065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(958968..959213)
Genome map
AA seq 81 aa AA seqDB search
MSEATAHNPEDYKVGKGNILGGVENPYLEKSEWGWAIDPIGLRLVLDDFYDRYQLPLFIV
ENGPDGPTVEDDYRMITFKNT
NT seq 246 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaagcaacagcacacaacccagaagactataaggttggtaaaggcaacatctta
ggtggtgtcgaaaatccataccttgagaaatctgaatggggctgggctattgatccaatt
ggacttcgtttggttttagatgacttttatgatcgttatcaattgccattgtttattgtc
gaaaatggtcctgatggtccgacagttgaggatgattatcgtatgattaccttcaaaaac
acttga

DBGET integrated database retrieval system