KEGG   Streptococcus thermophilus CNRZ1066: str1067Help
Entry
str1067           CDS       T00212                                 

Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
stc  Streptococcus thermophilus CNRZ1066
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:stc00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(959812..960009)
Genome map
AA seq 65 aa AA seqDB search
MSLLKPLTTEEATPANLKLEGIDFYHRYKEDIALFAELGFKVFRISIAWSRIFPNGDDAE
PNEAG
NT seq 198 nt NT seq  +upstreamnt  +downstreamnt
gtgtcccttttgaagcctttgactactgaagaagcaacaccagctaatctaaagcttgaa
ggtatagatttctatcaccgctataaagaggatattgcgctatttgcagagctgggcttc
aaggtctttcgcatatcgattgcttggtctcgtattttcccgaacggtgatgatgctgag
ccaaatgaagcagggtag

DBGET integrated database retrieval system