KEGG   Streptococcus thermophilus CNRZ1066: str1127Help
Entry
str1127           CDS       T00212                                 

Gene name
pepV
Definition
dipeptidase PepV
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
stc  Streptococcus thermophilus CNRZ1066
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:stc01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:stc00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(989550..990956)
Genome map
AA seq 468 aa AA seqDB search
MTIDFHAEVDKRKEALMEDLFGLLRINSERDDSKADEKHPFGPGPVKALEHFLALAERDG
YKTRNIDNYAGDFEFGQGDEVLGIFAHLDVVPAGSGWDTDPYEPVIKEGKLYARGSSDDK
GPTMACYYALKIIKELELPVSKRVRFIVGTDEESGWGDMDYYFAHNGLKDPDFGFSPDAE
FPIINGEKGNITAYLHFEGQNDGDFSLVSFNGGLRENMVPESASAEFTAPITLQELESKL
NDFVADQAVTGQVTEEAGVFHVTIHGKSAHGMMPQNGINGATYLALFLSQFDFKANAKTY
LDLIAETLHQDFFSEKTGLAYTDSKMGELTMNAGVFTFNKESEDNTIALNFRYPQGVNVD
GIKAGLEKLEGPKAVSLSEHGHVPHYVPVSDPMVQTLLSVYEKQTGLKGHEQIIGGGTFG
RLLKRGVAYGAMFPGYVNTMHQANEFTEVEDLYRAAAIYAEAIYELIK
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgacaattgattttcacgccgaagttgataaacgtaaagaagctttgatggaggacctt
tttggtcttttgcgtattaattcagagcgtgatgatagtaaggctgatgaaaagcaccca
tttggtcctggaccagtgaaagctctagaacattttcttgctttagctgaacgtgatggt
tataagactcgtaatattgataattacgctggtgactttgaatttggtcaaggtgatgaa
gtcttgggtatttttgcacacttggatgtggttccagcgggtagcggatgggacactgat
ccttatgaaccagtaatcaaagaaggaaagctttatgcccgtggttcatcagatgataaa
gggccaacaatggcttgttattatgctttgaaaattatcaaagagcttgagcttccagta
tctaagcgtgttcgctttattgttggtacagatgaagaatctggttggggtgatatggat
tattacttcgctcataatggattgaaagatcctgattttggcttttctccggatgcagaa
tttccaattatcaatggggaaaaaggaaatattactgcctatcttcattttgaaggacaa
aatgatggtgactttagcctcgtaagctttaatggtggcttgcgtgaaaatatggtccct
gaatctgcaagtgcagagtttacggcacctatcactttacaggaacttgagtctaaactt
aatgactttgttgctgatcaagcagtaaccggtcaagtgactgaagaagcaggtgttttc
catgtgactattcatggtaaatcagctcatggtatgatgcctcaaaatggtatcaatggg
gcaacatacttagcactcttccttagccaatttgacttcaaagctaatgctaagacttat
ttggatttaattgctgaaacacttcatcaagatttcttttctgaaaagacaggtcttgcc
tatacagattctaaaatgggtgagttaactatgaatgcaggtgtctttacctttaacaag
gaatctgaagataataccattgctttgaacttccgctaccctcaaggggttaatgtagat
ggtattaaggctggccttgaaaaacttgaaggacctaaggcggtcagtctttcagaacat
ggtcatgtgccgcattacgtaccagttagtgatcctatggtacagacacttctttcggtt
tatgagaaacagacaggtcttaaaggtcatgaacaaatcattggtggtggtacctttgga
cgtctccttaaacgtggtgttgcttatggtgctatgttccctggttatgtcaataccatg
caccaagcaaatgaatttactgaagttgaggacttataccgtgcagctgccatttatgca
gaagctatctatgagttgatcaagtaa

DBGET integrated database retrieval system