KEGG   Streptococcus thermophilus CNRZ1066: str1197Help
Entry
str1197           CDS       T00212                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
stc  Streptococcus thermophilus CNRZ1066
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:stc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    str1197 (pfkA)
   01230 Biosynthesis of amino acids
    str1197 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    str1197 (pfkA)
   00030 Pentose phosphate pathway
    str1197 (pfkA)
   00051 Fructose and mannose metabolism
    str1197 (pfkA)
   00052 Galactose metabolism
    str1197 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    str1197 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    str1197 (pfkA)
Enzymes [BR:stc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     str1197 (pfkA)
Protein phosphatases and associated proteins [BR:stc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     str1197 (pfkA)
Messenger RNA biogenesis [BR:stc03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     str1197 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1048358..1049425)
Genome map
AA seq 355 aa AA seqDB search
MCYNENVKYIKGVSGIMKRIAVLTSGGDAPGMNAAVRAVVLKAISEGIEVFGINRGYAGM
VEGDIFKLDAKRVENILSRGGTFLQSARYPEFAQLEGQLKGIEQLKKYGIEGVVVIGGDG
SYHGAMRLTEHGFPAVGLPGTIDNDIVGTDYTIGFDTAVATATEALDKIQDTAFSHGRTF
VVEVMGRNAGDIALWAGIASGADQIIVPEEEYDINEVVRKVKEGYESGEKSHHIIVLAEG
VMGAEEFAAKMKEAGDTSDLRATNLGHVIRGGSPTARDRVLASWMGAHAVDLLKEGIGGV
AVGIHNEQLVESPILGTAEEGALFSLTEDGKIIVNNPHKARLDFAELNRSLANLK
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
ttgtgttataatgaaaatgttaaatatataaaaggagtatcaggaataatgaaacgtatt
gctgttttgaccagtggtggagatgcccctggtatgaacgctgccgttcgtgcagttgtt
ctcaaagcaatttctgaaggaattgaagtgttcggcattaaccgtggatacgccggtatg
gttgaaggagatatcttcaaacttgatgccaaacgcgtagaaaacatccttagccgtggt
ggcactttccttcagtctgctcgctatcccgagtttgcccaacttgaaggtcaacttaaa
ggtattgagcaacttaaaaaatatggaatcgaaggtgtagttgttattggtggagatggt
tcttaccatggtgctatgcgtttgactgaacatggtttcccagcagttggtctcccagga
actatcgataacgatatcgttggtacagactatacaattggatttgatacagccgttgca
actgcaacagaagctttggataaaatccaagatacagctttcagtcatggacgtactttt
gtcgttgaggtaatgggacgtaacgctggtgatatcgctctttgggctggtattgcttca
ggtgctgaccaaattattgtgccagaagaagaatatgacatcaacgaagtggttcgtaaa
gttaaagaaggttatgaatctggcgaaaaatctcaccacattattgtgcttgctgagggc
gttatgggtgctgaagagtttgcagctaaaatgaaagaagctggagatacatcagacctt
cgtgctacaaatcttggacacgtaattcgtggtggttcaccaactgcacgtgaccgtgtt
cttgcttcatggatgggtgcacatgccgttgatcttcttaaagaaggaattggtggtgtt
gctgtgggtatccataatgaacagcttgttgaaagtccaatccttggtacagcagaagaa
ggtgctttgttcagtcttactgaagacggtaaaattatcgtaaacaatccacacaaagct
cgtcttgattttgcagagcttaaccgttctttagctaacttgaaataa

DBGET integrated database retrieval system