KEGG   Streptococcus thermophilus CNRZ1066: str1204Help
Entry
str1204           CDS       T00212                                 

Gene name
gpmA
Definition
phosphoglyceromutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
stc  Streptococcus thermophilus CNRZ1066
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:stc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    str1204 (gpmA)
   01230 Biosynthesis of amino acids
    str1204 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    str1204 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    str1204 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    str1204 (gpmA)
Enzymes [BR:stc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     str1204 (gpmA)
Exosome [BR:stc04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   str1204 (gpmA)
  Exosomal proteins of melanoma cells
   str1204 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1058873..1059565)
Genome map
AA seq 230 aa AA seqDB search
MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIEFDKAYTSVLKR
AIKTTNLALEASDQLWVPVEKSWRLNERHYGGLTGKNKAEAAEQFGDEQVHIWRRSYDVL
PPKMDRDDEYSAHKDRRYASLDDSVIPDAENLKVTLERALPFWEDKIAPALKDGKNVFVG
AHGNSIRALVKHIKKLSDDEIMDVEIPNFPPLVFEFDEKLNVVSEYYLGK
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaattggttttcgctcgccacggtgagtctgaatggaacaaagctaatcttttc
acaggttgggctgacgtagatctttctgaaaaaggtactcaacaagctattgacgctggt
aaattgattaaagaagctggtattgaatttgacaaagcttacacttcagtattgaaacgt
gcgatcaaaacaactaaccttgcgcttgaagcctctgaccaactttgggttccagttgaa
aaatcatggcgcttgaacgaacgtcactacggtggtttgactggtaaaaataaagcagaa
gctgctgaacaatttggtgatgagcaagttcacatctggcgtcgttcatacgatgtattg
cctccaaaaatggaccgtgatgatgagtactcagcacacaaagaccgtcgttacgcttca
cttgacgattcagtaattccagatgctgaaaacttgaaagtaactttggaacgtgccctt
ccattctgggaagataaaattgctccagctcttaaagatggtaaaaatgtattcgtaggt
gcacatggtaactcaatccgtgcccttgtaaaacacatcaaaaaattgtcagatgacgaa
atcatggatgttgaaattccaaacttcccaccattggtatttgaatttgacgaaaaattg
aacgttgtttctgaatattacctcggaaaataa

DBGET integrated database retrieval system