KEGG   Streptococcus thermophilus CNRZ1066: str1588Help
Entry
str1588           CDS       T00212                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
stc  Streptococcus thermophilus CNRZ1066
Pathway
stc00260  Glycine, serine and threonine metabolism
stc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
stc01100  Metabolic pathways
stc01110  Biosynthesis of secondary metabolites
stc01130  Biosynthesis of antibiotics
stc01230  Biosynthesis of amino acids
Module
stc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:stc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    str1588 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    str1588 (trpB)
Enzymes [BR:stc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     str1588 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AAV63118
UniProt: Q5LYI7
Position
complement(1413431..1414639)
Genome map
AA seq 402 aa AA seqDB search
MTYQQPDAKGFYGKFGGQFVPETLMTAVIELDKAYREAKEDSSFQAELDDLLKNYVGRET
PLYHAKRLTDYIGGAQIYLKREDLNHTGAHKINNALGQVLLAKRMGKKKIIAETGAGQHG
VATATAAALFDMDCTIYMGEEDVKRQALNVFRMELLGAKVFSVTDGSRVLKDAVNAALRA
WVAGIEDTHYIMGSALGPAPFPEIVRDFQSVIGREAKRQYAEISGGKLPDAVMACIGGGS
NAIGMFYPFVNDKSVAMYGAEASGLGLDTEKHAATFAKGRPGILHGALMDVLQDAHGQIM
EAFSISAGLDYPGVGPEHCYFNEIGRATYDSITDEEALEGFKLLSCLEGIIPALESSHAI
ALAQKVAAKMSPDQSLIVCLSGRGDKDVMQVKERFEAEAEGK
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgacatatcaacaacctgatgcaaaaggattttacggaaaattcggcggtcagttcgtt
cccgaaacgctgatgacagccgttattgaattggataaggcctatcgtgaagccaaagaa
gattcaagtttccaagcggaattggatgacctccttaaaaactatgtgggccgtgaaaca
cctctttaccacgccaaacgtttgacagattatatcggtggagcgcaaatttaccttaaa
cgtgaagaccttaaccacacaggggcccacaagattaacaatgccctcggtcaagtcttg
cttgctaaacgtatgggtaagaagaaaatcatcgccgaaactggtgcaggtcaacacggt
gtcgcaacagcgacagccgctgctcttttcgacatggactgtaccatctatatgggtgag
gaagatgtgaaacgtcaggcgcttaacgttttccgtatggagttgcttggtgccaaagtt
ttcagtgttaccgatggctcacgcgtgcttaaggacgctgtaaatgctgctcttcgtgct
tgggttgcaggtatcgaggatactcactacatcatgggatctgcccttggtccagcacca
ttcccagaaattgttcgtgatttccaatctgttatcggccgtgaagccaaacgccaatat
gcagagatttctggcgggaaactgcctgatgctgtaatggcttgtatcggtggtggttca
aatgctatcggcatgttctacccatttgtcaatgataaatcagtagctatgtatggtgct
gaggcttctggtttgggacttgatactgaaaaacacgccgcaacctttgccaaaggtcgc
ccaggtatccttcatggagcgcttatggatgtcctccaagatgctcatggtcaaataatg
gaagctttctctatctcagctggtctggactacccaggggttggtcctgagcactgttat
ttcaacgaaataggacgtgcgacttacgactctatcacagatgaagaagcgctagaagga
ttcaaacttctgtcatgtttggaaggtattatcccagctcttgagtctagccatgctatt
gcgcttgcacaaaaagtggcagctaagatgtcgccagaccaaagcctcatcgtctgcctc
tcaggtcgtggggataaggacgttatgcaggttaaagaacgttttgaagctgaagcagaa
gggaaataa

DBGET integrated database retrieval system