KEGG   Streptococcus thermophilus CNRZ1066: str1630Help
Entry
str1630           CDS       T00212                                 

Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
stc  Streptococcus thermophilus CNRZ1066
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:stc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    str1630
Enzymes [BR:stc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     str1630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1451546..1452091)
Genome map
AA seq 181 aa AA seqDB search
MELLKEHTVDFIFFSYYSSRVASGDPEVNEKTAGNIFAPIKNPYLESSEWGWQIDPLGLR
ITLNAIWDRYQKPMFIVENGIGAVDTPDENGYVEDDYRIDYLAAHINTMRDAINEDGVEL
WGYTTWGCIDLVSAGTGEMKKHYGFIYIDRDNDGKGSLKSSKKKSFNRYKEVIASNGASV
E
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
ttggagcttctcaaagagcatactgttgatttcattttcttctcttattattcaagtcgt
gtggcttcaggtgatcccgaagttaatgaaaagactgccggcaatatctttgcccctatt
aaaaatccatatttagaatcttcagagtggggttggcaaattgacccactaggccttcgt
attaccctcaatgctatttgggatcgttaccagaaaccgatgtttatcgttgagaatggg
attggtgctgtggatacaccagatgaaaatggttatgttgaagacgattatcgtattgac
tacttggcagcccacattaataccatgagggatgccatcaatgaagatggtgtagaactt
tggggatacacaacctggggttgtatcgatcttgtttctgccggaactggtgaaatgaaa
aaacattatggtttcatctatatagaccgcgacaatgatggtaagggtagccttaaaagc
tctaagaaaaaatcatttaacaggtacaaagaagttatcgcaagtaacggtgcctctgta
gaatag

DBGET integrated database retrieval system