KEGG   Streptococcus thermophilus CNRZ1066: str1711Help
Entry
str1711           CDS       T00212                                 

Gene name
proB
Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
stc  Streptococcus thermophilus CNRZ1066
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:stc01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:stc00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1521215..1522018)
Genome map
AA seq 267 aa AA seqDB search
MKRNFDSVKRLVIKIGTSSLVLPSGKINLEKIDQLAFVISSLHNKGIEVVLVSSGAMGFG
LNVLDLETRPAEVGKQQAVSSVGQVAMMSLYSQVFSHYQTKVSQLLLTRDVVEYPESLAN
AINAFESLFELGVVPIVNENDAVSVDEMDHATKFGDNDRLSAIVAKVVGADLLIMLSDID
GLFDKNPNVYEDATLRSYVPEITEEILASAGAAGSKFGTGGMMSKIKSAQMVFENQSQMV
LMNGENPRDILRVLEGAKIGTLFKQED
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaaattttgactcagtaaaacgcctagttatcaaaatcgggaccagctccttg
gttttgccatcagggaaaattaatcttgaaaaaatcgatcagctagcttttgtgatttct
agcttacacaataaagggattgaggttgtcctcgtatcctctggtgctatgggatttggt
cttaatgttctagatcttgagacgcgtccagcagaggtaggtaagcaacaggctgtctca
agtgtagggcaggtggccatgatgagcctttattctcaagtcttttcacattaccaaacc
aaggtatctcagcttcttttgacccgtgatgtggtcgagtaccccgagagtttggccaat
gccatcaatgccttcgaaagcctctttgagcttggagtagttccaattgttaatgaaaat
gatgctgtcagtgtagatgaaatggatcatgcaactaagtttggggacaatgaccgcttg
tcagctatcgtagctaaggttgttggtgcggacttacttatcatgttgtcagatattgat
gggctctttgataagaacccaaatgtctatgaggatgcaacccttcgtagctatgtacca
gagattaccgaggaaattctagcctcagctggtgctgctggtagtaaatttggtacgggt
ggtatgatgagtaaaattaagtcagctcagatggtttttgaaaatcaaagccaaatggtt
ttaatgaatggtgaaaatccacgtgacattcttcgtgtcctagaaggagccaaaatcggt
acactttttaaacaggaggactaa

DBGET integrated database retrieval system