KEGG   Streptococcus thermophilus CNRZ1066: str1767Help
Entry
str1767           CDS       T00212                                 

Gene name
recD
Definition
exodeoxyribonuclease V
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
stc  Streptococcus thermophilus CNRZ1066
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:stc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    str1767 (recD)
Enzymes [BR:stc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     str1767 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1580139..1582643
Genome map
AA seq 834 aa AA seqDB search
MQEFYFSGTIERIIFENASNFFRILLLEIDETDSDFEDYEIIVTGTMGDVMEGEDYTFWG
QLTNHPKYGKQLQMTRYERSKPSASGLIKYFSSDNFKGIGKKTAERIVEIYGEDPIDKIL
EDPSKLEQIPNLSKVNREAFLAKLKINYGTEQILSKLSSYGLTPKAASQIFNQYKEESLN
LIEKYPYLLVEEVQGIGFKMADQLAERLGIASDAPERLRAALIHCLLEASMEEGDTYIEA
KSLLERTIILLESSRQIELDPALVAHQLTNLIQEDKVQNIETKIFDNTLYFAEQGIYTHL
TRITKDQPDISAEDKIQASLERVEDELGITYDKVQKDAIIKALQSKVFILTGGPGTGKTT
VINGIIKTYADLHGLDLKKSDLPIILAAPTGRAARRMNELTKLPSATIHRHLGLNGEDDF
KTLDDYLDCDLIIIDEFSMVDTWLANQLFESISDTTQVIIVGDQDQLPSVGPGQVLADLL
QIDDLPKVSLTKIFRQSEDSTIVTLASQIRQGQLPTDFTEKKADRSYFEANANHIPQMVP
KIVSAAIKSGIAAQDVQILAPMYRGQAGINNLNTIMQDLLNPKEKANQFAFNDIFFRKND
KILHLVNDTELNVFNGDIGIITDLIPGKYTESKQDEIYMSFDGNEVIYPRNEWNKITLAY
AMSIHKSQGSEFPVVILPITRQSGRMLQRNLIYTVITRAKSKLVMLGEIAAFDYAVHNEG
AKRNTYLIQRFEQTYTQAVDKSVEKNVKNEGTDAFNQTKTENNRPSETLENKDFSENINP
SQTLINTYSHPVDKSVNKPVQTEENYRLTEENWATIDPMIGLSEDDIAAFFNNN
NT seq 2505 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaattttatttttcaggaactatcgagcgcatcatttttgaaaatgccagtaat
ttttttcgtatcctactcttagaaattgatgaaactgacagtgattttgaagactatgaa
atcattgttactggaactatgggggatgtcatggagggggaagactataccttctggggt
cagctaaccaatcaccccaaatatggcaaacaactccaaatgactcgctacgagcgttca
aaaccctctgccagtggccttatcaaatatttctccagtgataatttcaaaggaatcggt
aagaaaacggccgagcgtattgtcgagatttatggcgaagaccctattgacaagattctc
gaagaccctagtaaattagaacagattcctaatctgtccaaggtaaaccgagaagccttc
cttgcaaaattaaaaatcaactatggtactgaacaaatcttgtccaaactttccagctat
ggactcacaccaaaggctgcctcacaaattttcaaccaatataaggaagaatcacttaac
cttatcgaaaaatatccttatctcttggtagaggaagtccagggaattggatttaaaatg
gccgatcaactagccgaacgcctagggattgctagcgatgctcctgagcgtttacgagcc
gccctaattcactgtctgctagaagctagtatggaagaaggggacacctacatcgaagcc
aagtccttgcttgaacggactatcattcttttggaaagttctcgccagattgaacttgac
cctgccttggttgctcaccaattaaccaacctcatccaagaggataaggtgcaaaatata
gagactaaaatttttgataataccctatattttgcagaacagggcatctatacccaccta
actcgtatcacgaaagaccagcctgacatcagtgctgaggacaaaatccaagcaagtctt
gaaagggtggaagatgagcttggtatcacctatgacaaggttcaaaaagatgccattatt
aaggccctacaaagcaaggtcttcatcctgacaggtggtcccggaacaggaaaaaccact
gttattaacggaattattaaaacctatgctgaccttcatggtttagacctcaaaaagtct
gatttacccattattttagcagcgccaacgggacgggctgctcgtcggatgaacgaactg
accaagctccctagtgccactatccatagacatttggggcttaatggcgaggacgatttc
aagaccttagatgactatctcgattgcgatttgattatcatcgatgagttctctatggtt
gatacttggttggccaatcaactcttcgaaagcatttccgatactactcaagtaatcatt
gtaggtgaccaagatcagctaccttctgtaggccctggccaagtcttagctgaccttttg
cagattgatgacttgcctaaggtttccctaaccaaaattttcagacaatctgaggattcc
actattgttaccttagctagccagatacgccaaggccaactacccactgatttcacagag
aaaaaagctgaccgatcatactttgaggctaatgctaaccatattccacagatggtccct
aaaattgtctctgccgctattaaaagtgggatcgctgctcaggatgtacagattctggcc
cccatgtaccggggacaggctggtatcaacaatctcaataccattatgcaggatctactt
aatcccaaagaaaaagccaatcaatttgcctttaatgatattttcttccgtaagaatgac
aagattctccacctggtcaacgatacagaactcaatgtcttcaatggcgatatcggaatc
attactgatctcatacctggtaaatatactgaaagtaagcaagacgaaatttacatgtcc
ttcgatggcaatgaggttatctatcctcgtaacgaatggaataagattactctggcctat
gccatgtctatacacaaatcccaagggagtgaattcccagtcgttatccttcccatcaca
cgccaaagtgggcgtatgcttcaacgtaacctcatctacaccgttatcacacgcgccaag
agtaaactggtcatgttgggggaaatcgcagccttcgattatgccgttcacaacgagggg
gccaaacgtaatacctacctcatccaacgttttgaacaaacttatacacaagctgttgat
aagtctgtcgaaaagaatgttaaaaacgagggaacagacgccttcaatcaaacaaaaacg
gaaaacaatagaccctcagaaacccttgaaaacaaagacttctcggaaaatatcaatcca
tcccaaactcttattaacacttattcacatcctgtggataagtctgttaacaaacctgtg
caaacagaagaaaactatcgtttaactgaagaaaactgggcaactatcgacccaatgata
ggtctcagcgaagacgatattgcagccttttttaacaacaactag

DBGET integrated database retrieval system