KEGG   Streptococcus pseudopneumoniae: SPPN_00830Help
Entry
SPPN_00830        CDS       T01590                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
std  Streptococcus pseudopneumoniae
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:std00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:std00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(123337..127266)
Genome map
AA seq 1309 aa AA seqDB search
MKHEKQQRFSIRKYAVGAASVLIGFAFQAQTVAADGVTPTTTENQPTIHTVSDSPQSSEN
RTEETPKAELQPEAPKTVETETPATDKVASLPKTEEKPQEEVSSTPSDKAEVVTPTSAEK
ETANKKAEEAKEIDSKESNTDKTDKDKPAEKDAKKNEAKAEADKPATEAGKERAATVSEK
LAKKKIVSIDAGRKYFSPEQLKEIIDKAKHYGYTDLHLLVGNDGLRFMLDDMSITANGKT
YASDDVKRAIEKGTNDYYNDPNGNHLTESQMTDLINYAKDKGIGLIPTVNSPGHMDAILN
AMKELGIQNPNFSYFGKESARTVDLDNEQAVAFTKALIDKYAAYFAKKTEIFNIGLDEYA
NDATDAKGWSVLQADKYYPNEGYPVKGYEKFIAYANDLARIVKSHGLKPMAFNDGIYYNS
DTSFGSFDKDIIVSMWTGGWGGYDVASSKLLAEKGHQILNTNDAWYYVLGRNADDQGWYN
LDQGLNGIKNTPITSVPKTEGADVPIIGGMVAAWADTPSARYSPSRLFKLMRHFANANAE
YFAANYQPAEKALETIPKDFNRYTAESFAAVKEAEKAIRSLDSNLSRAQQDTINQAIVNL
QEAIKNLVFTPEAQKEEDAKRELEKLNKNKVISIDAGRKYFSLDQLKRIVDKASELGYSD
AHLLLGNDGLRFLLDDMTITANGKTYASDDVKKAIIEGTKAYYDDPNGTALTQTEVTELV
QYAKEKGIGLIPAINSPGHMDAMLVAMEKLGITNPQANFDKVSKTTMDLENQEAVGFTKA
LIGKYMDYFADKSKIFNYGTDEYANDATNAQGWYYLKWYGLYNKFADYSNSLAAMAKERG
LQPMAFNDGFYYEDKDDAEFDKDVLISYWSKGWWGYNLASPQYLANKGYKFLNTNGDWYY
VLGNHKQDEAYPLSKAIENSGKVPFNQLASTKYPEVDLPTVGSMLAIWADKPSAEYKEEE
IFELMTAFADHNKDYFRANYNALREELAKIPTNLDGYSTESLAALKAAKDGLNLNLNRSK
QAELDALVGKLKAALQGLKPAATHSGSLDENEVAANVETRPELITRTEEIPFEVIKKENP
NLPAGQENIITAGVKGERTHYISVLTENGKTTETVLDSQVTKEVINQVVEVGAPVTHKGD
ESGLAPTTEVKPRLDIQEEEIPFTTVTRENPLLLKGKTQVITKGVNGHRSNFYSVSTSAD
GKEVKTLVNSVVAQEAVTQIVEVGTMVTHVGDENGQAAIAEEKPKLEILSQPAPSTAPAE
ESKALPQDPAPVVIEKKLPETGTHDSAGLVVAGLMATLAAYGLTKRKED
NT seq 3930 nt NT seq  +upstreamnt  +downstreamnt
atgaaacatgaaaaacaacagcgtttttctattcgtaaatacgctgtaggagcagcttct
gttctaattggatttgccttccaagcacagactgttgcagccgatggagttactcctact
actacagaaaaccaaccgaccatccatacggtttctgattcccctcaatcatccgaaaat
cggactgaggaaacacctaaagcagagcttcaaccagaagctccaaaaactgtagaaaca
gaaactccagctactgataaggtagctagtcttccaaaaacagaagaaaaaccacaagag
gaagttagttcaactcctagtgataaagcagaggtggtaactccaacttctgctgaaaaa
gaaactgctaataaaaaggcagaagaagctaaagagattgattctaaagagtcaaataca
gacaagactgacaaggataaaccagctgaaaaagatgctaaaaaaaatgaagcgaaagca
gaggctgacaaaccggcaacagaggcaggaaaggaacgtgctgcaactgtaagtgaaaaa
ctagcgaaaaagaaaattgtttctattgatgctggacgtaaatatttctcaccagaacag
ctcaaggaaatcatcgataaagcgaaacattatggctacactgatttacacctattagtc
ggaaatgatggacttcgtttcatgttggacgatatgagcatcacagctaacggcaagacc
tatgccagtgacgatgtcaaacgcgccattgaaaaaggtacaaatgattattacaacgat
ccaaacggcaatcacttaacagaaagtcaaatgacagatctgattaactatgcaaaagat
aaaggtatcggtctcattccgacagtaaatagtcctggtcacatggatgcgattctcaat
gccatgaaagaattgggaatccaaaaccctaactttagctattttgggaaggaatcagcc
cgtactgtcgatcttgacaacgaacaagctgtcgcttttacaaaagcccttatcgacaag
tatgctgcttatttcgcgaaaaaaactgaaatcttcaacatcggacttgatgaatatgcc
aatgatgcgacagatgctaaaggttggagtgtgcttcaagctgataaatactatccaaac
gaaggctaccctgtaaaaggctatgaaaaatttattgcctacgccaatgacctcgctcgt
attgtaaaatcgcacggtctcaaaccaatggcctttaacgacggtatctactacaatagc
gacacaagctttggtagttttgacaaagacatcatcgtttctatgtggactggtggttgg
ggaggctacgatgtcgcttcttctaaactactagctgaaaaaggtcaccaaatccttaat
accaatgatgcttggtactacgttcttggacgaaacgctgatgaccaaggttggtacaat
ctcgatcaggggctcaatggtattaaaaacacaccaatcacttctgtaccaaaaacagaa
ggagctgatgtcccaatcatcggtggtatggtagctgcttgggccgataccccatctgca
cgttattctccatctcgcctcttcaaactcatgcgtcattttgcaaatgccaacgctgaa
tacttcgcagccaactatcaacctgcagaaaaagcactagaaactattccaaaagacttt
aaccgctatactgctgaaagttttgctgctgtcaaagaagctgaaaaagccatccgttca
ctcgatagcaacctcagtcgtgctcaacaagataccattaaccaagcaattgttaacctt
caagaagctattaaaaacttagtctttacaccagaagctcaaaaagaagaagatgctaaa
cgcgaacttgaaaaactgaataagaataaagtcatttccatcgatgcaggtcgtaaatac
ttctctttagatcaactcaaacgcatcgtagacaaggccagcgagctcggctattctgat
gcccatctccttctaggaaatgatggccttcgtttcctactcgatgatatgaccattact
gccaacggaaaaacctacgctagtgatgacgttaaaaaagccattatcgaaggaacgaaa
gcttactacgacgatccaaacggtactgcgctgacacaaacagaagtgacagagcttgtt
caatacgctaaggaaaaaggtattggtctaatccccgctatcaatagtccaggacatatg
gatgctatgctcgttgccatggaaaaacttggcatcacgaatcctcaagccaactttgat
aaggtctcaaaaacaaccatggaccttgaaaatcaagaagcagttggatttaccaaagcc
cttatcggtaagtatatggattactttgctgataaatcaaagatattcaactatggtaca
gatgaatatgccaatgatgcgaccaacgcccaaggttggtattacctcaaatggtatgga
ctctataacaagttcgcagattattctaacagcctagctgctatggctaaggaaagaggg
ctacaaccaatggccttcaacgatggcttctactatgaagacaaggatgatgctgaattc
gataaagatgtcttgatttcttactggtctaaaggctggtggggctacaaccttgcatca
cctcagtatctagcaaacaaaggttataagttcttgaataccaacggtgactggtactat
gttttaggaaatcacaaacaagatgaagcttatcctctttcaaaggcaattgaaaattct
ggaaaagttccattcaatcaactagcttctaccaaatatcctgaagttgaccttccaaca
gttggtagtatgttagctatatgggcagataaaccaagcgctgagtacaaggaagaggaa
atctttgaactcatgactgcctttgcagaccacaacaaagactacttccgtgctaattat
aatgctctccgcgaagaattggctaagattcctacaaacttagacggatacagcacagag
agcctagctgcactcaaggcagcaaaagatggactgaaccttaacctcaaccgcagcaaa
caagctgaattagacgcactagtaggtaagctcaaggctgctcttcaaggcctcaaacca
gctgcaactcattcaggaagcctagatgaaaatgaagtggctgccaatgttgaaaccaga
ccagaactcatcacaagaactgaagaaattccatttgaagttatcaagaaagaaaatcct
aacctcccagctggtcaggaaaatattatcacagcaggagtcaaaggtgaacgaactcat
tacatctctgtactcactgaaaatggaaaaacaacagaaacagtccttgatagccaggta
accaaagaagttataaaccaagtggttgaagttggcgctcctgtaactcacaagggtgat
gaaagtggtcttgcaccaactactgaggtaaaacctagactggatatccaagaagaagaa
attccatttaccacagtgactcgtgaaaatccactcttactcaaaggaaaaacacaagtc
attactaagggtgtcaatggacatcgtagcaacttctactctgtgagcacttctgccgat
ggtaaggaagtgaaaacactcgtaaatagtgtcgtagcacaggaagccgttactcaaata
gtcgaagtcggaactatggtaacacatgtaggcgatgaaaacggacaagccgctattgct
gaagaaaaaccaaaactagaaatcctaagccaaccagctccatcaactgctcctgctgag
gaaagcaaagctcttcctcaagatccagctcctgtggtaatagagaaaaaacttcctgaa
acaggaactcacgattctgcaggactagtagtcgcaggactcatggccacactagcagcc
tatggactcactaaaagaaaagaagactaa

DBGET integrated database retrieval system