KEGG   Streptococcus pseudopneumoniae: SPPN_00840Help
Entry
SPPN_00840        CDS       T01590                                 

Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
std  Streptococcus pseudopneumoniae
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:std00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SPPN_00840
Enzymes [BR:std01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     SPPN_00840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
128644..130431
Genome map
AA seq 595 aa AA seqDB search
MTRFEIRDDFYLDGKPFKILSGAIHYFRIPPEDWYHSLYNLKALGFNTVETYVAWNLHEP
REGEFHFEGALDLERFLQTAQDLGLYAIVRPSPFICAEWEFGGLPAWLLTKDMRIRSSDP
AYIEAVGRYYDQLLPRLVPHLLDNGGNILMMQVENEYGSYGEDKAYLRAIRQLMEERGVT
CPLFTSDGPWRATLKAGTLIEDDLFVTGNFGSKAPYNFSQMQEFFDEHGKKWPLMCMEFW
DGWFNRWKEPIITRDPKELADAVREVLEQGSINLYMFHGGTNFGFMNGCSARGTLDLPQV
TSYDYDALLDEEGNPTAKYLAVKKMMATHFPEYPQLEPLYKESMELDAIPIVEKVSLFET
LDSLSSPVESLYPKKMEELGQSYGYLLYRTETNWDAEEERLRIIDGRDRAQLYVDGQWVK
TQYQTEIGEDIFYQGKKKGLSRLDILIENMGRVNYGHKFLADTQRKGIRTGVCKDLHFLL
NWKHYPLPLDNPEKIDFSKGWTQGQPAFYAYDFTVEEPKDTYLDLSEFGKGVAFVNGQNL
GRFWNVGPTLSLYIPHSYLKEGANRIIIFETEGQYKEEIHLTRKPTLKHIKGENL
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgacacgatttgagatacgagacgatttctatttagatgggaaaccgttcaagattttg
tccggcgccattcattattttaggattcctccagaggattggtatcattcgctctataac
ttgaaggctcttggttttaatacggtagagacttatgtggcttggaatttacacgagcct
cgtgagggtgagtttcattttgaaggagctctggatttggagcgatttctacagacagcg
caagacttgggtctctacgctatcgttcgtccgtcacccttcatctgtgcggagtgggaa
ttcggtggtttaccagcctggctcttaaccaaagacatgaggattcgttcttcagatcct
gcctatattgaggctgtcggtcgctattatgatcagctcttgccacgactggttccacat
ctgttggacaatggtggcaatatcctcatgatgcaggttgaaaatgagtatggttcttat
ggagaagataaggcttacctgagagccattcgacagctgatggaagagcgtggcgtaacc
tgtcctctctttacatcagatggtccttggagagctactctgaaagcgggaaccttaatc
gaagatgacctctttgtaacagggaactttggttctaaggcaccttacaacttttcacag
atgcaggaattctttgatgagcatggcaagaaatggccgctcatgtgtatggagttctgg
gatggctggttcaatcgttggaaagaaccgattatcacacgggatcctaaggaattggca
gatgcagttcgagaggttttggaacaaggctccatcaatctttacatgttccacggtggt
acaaactttggcttcatgaatggttgctcagctcgagggactttggacctgccacaagtt
acatcttatgattacgatgctcttctggatgaagaaggaaatccaactgccaaatacttg
gcagtcaagaagatgatggcaacacatttcccagagtatccgcagttagaaccactctac
aaagagagtatggagttggatgctataccaatagtagaaaaagtttccttgtttgaaacc
ttggatagcttgtcaagtccagtagaaagcctctatcctaaaaagatggaggagctggga
caaagttatggctacctactttatcgaacagaaacaaactgggatgcagaagaagaaaga
cttcgtatcattgatggtcgagatagggcccagctgtatgtcgatggtcagtgggttaaa
actcaatatcagacagagattggggaagatattttttatcaaggtaaaaagaaagggcta
tctaggttagatatcttgatagaaaatatggggcgtgtcaactatgggcataagttctta
gcggatacgcaacgtaagggaattcggacaggggtctgtaaggatctgcatttcttacta
aactggaaacactatccactcccactagacaatcctgagaaaattgatttttcaaaagga
tggactcaaggacaaccagccttttacgcttatgactttacagtcgaagagccaaaagat
acttacctagacttgtctgagtttggtaagggggttgcctttgtcaatgggcagaatcta
ggacgtttttggaacgttggcccaactctctcactttatatccctcatagctatctcaag
gaaggtgccaaccgcatcattatctttgaaacagaaggtcaatataaagaagagattcat
ttaactcgtaaacctacactaaaacatataaagggggaaaacttatga

DBGET integrated database retrieval system