KEGG   Streptococcus pseudopneumoniae: SPPN_02015Help
Entry
SPPN_02015        CDS       T01590                                 

Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
std  Streptococcus pseudopneumoniae
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:std00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
328802..330181
Genome map
AA seq 459 aa AA seqDB search
MLRFPKDFVWGSSTSGPQTEGRIAGDGKGDNLWDYWFQVEPNRYYNGIGPDKTSSFYENW
EQDIELLLETGHTAFRISIQWSRIFPQGCGKVNPQGVDFYRKVFEAIKAKGIRLLVNLYH
FDLPFALQEAGDGWENKATVSAYENYARFCFETYGDLVDQWITFNEPIVPVEFGYFYDAH
YPHKVDAEAAVKVAYHTQLASSRAVKACHELLPDSKIGIVLNLTPAYPRSQHPADVKAAR
IADLFQAQSFLDPSVLGTYPQELVEILHEYGLLPDATEEELEVIRDNTVDFLGVNYYQPL
RVMAPRFAKNPESPLLPEHFYEPYVMPGRKINPHRGWEIYEQGIYDIAQNIKENYGNIEW
MLTENGMGVEGEEKFRENGMIQDDYRIDFVKAHLRELHRAIEDGANCKGYLIWTFIDCWS
WLNSYKNRYGLVELDLETQERRLKKSGYWFKELSDNNGF
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgctaagatttccaaaggattttgtctggggatcctctacttctgggccgcagacagaa
ggacgtatagctggtgacggtaagggagataatctctgggattactggttccaagtggag
ccaaatcgctactataatggaattggtccagataaaacatcaagcttttatgaaaactgg
gaacaggatattgagctactgttagaaactggtcacacggcctttcggatttctattcag
tggtcacggatttttccacaaggatgtggaaaagtcaatcctcaaggtgtggatttctat
cgtaaggtttttgaggctattaaggctaaggggattcgtcttttagtcaatctctaccac
tttgatttgccttttgctcttcaagaagctggtgatggttgggaaaataaggcgactgtc
tcagcctatgaaaactatgctcgtttttgttttgagacttatggagatctagtggatcaa
tggattacctttaacgagcccatcgttccagtagaatttggctatttttacgatgcccat
tatccacataaggtggatgcagaggcagccgttaaagtagcatatcatacacaattggcc
agcagtcgggcggttaaggcttgtcatgaacttttgccagattccaagattgggattgtc
ctcaacttgacaccggcttatccacgtagccagcatcctgctgatgtcaaggcagctcgt
attgcggacctttttcaggcccaatctttcttagatccatctgtcttggggacttatcca
caggagttggtagaaatcttacatgaatacggtctcttgcctgatgctacagaggaggag
ttggaagtcattcgtgacaatacggtagacttccttggtgtcaactactatcaacctttg
cgtgttatggcacctcgatttgctaagaatccagagagtcctcttttgccagaacatttt
tatgagccttatgtaatgcctggacgtaaaatcaatcctcatcgtggctgggagatttat
gagcaagggatttatgacatcgcccaaaatatcaaggaaaattatggcaatattgagtgg
atgttgacagagaatggtatgggtgttgaaggagaggaaaaattccgtgagaatggaatg
attcaagatgattaccgtattgactttgtaaaagctcatcttcgtgaacttcaccgtgcc
attgaagacggagccaattgtaagggctacttaatttggacctttatcgattgttggtca
tggcttaacagctataaaaatcgctatggtttggtcgaattagacttggaaacgcaagaa
cgtcgtctgaaaaaatcagggtactggttcaaggaattaagcgataataatggattttaa

DBGET integrated database retrieval system