KEGG   Streptococcus pseudopneumoniae: SPPN_02410Help
Entry
SPPN_02410        CDS       T01590                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
std  Streptococcus pseudopneumoniae
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:std00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SPPN_02410
Enzymes [BR:std01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     SPPN_02410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
418453..419433
Genome map
AA seq 326 aa AA seqDB search
MVKSLEGVTDMSTKVNHAKTAICGIINVTPDSFSDGGQFFALEQALQQARKLIAEGACML
DIGGESTRPGSSYSYVEIEEEIQRVVPVIKAIRKESDVLISIDTWKSQVAEAALAAGANL
VNDITGLMGDEKMAEVVAKAGAKVVIMFNPVIARPQHPSSLIFPHFGFGQAFTEEELANF
EKLPIEDLMETFFERALARANQAGIAQENILLDLGIGFGLTKKENLLLLRDLDKLHQKGY
PIFLGVSRKRFVINILEENGFEVNPETELGFRNRDTASAHVTSIAARQGVEVVRVHDVAN
HRMAVEIASAIRLADEAENLDLKQYK
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaaagccttgagggagtgaccgatatgtcaactaaagtaaatcatgcaaagaca
gctatttgcggaattatcaatgtaaccccagattccttttcggatggtggtcaatttttt
gctcttgagcaggcactccagcaggctcgtaaattgatagcagaaggggcttgtatgcta
gatatcggcggagaatcgactcggccgggaagtagctatagctatgttgagatagaagag
gaaatccagcgtgttgttccagtgattaaagcgattcgcaaggaaagtgatgtcctcatc
tctattgatacttggaagagtcaggtagcagaagctgctttggctgctggtgccaatcta
gttaatgatatcactggtcttatgggtgatgagaaaatggcggaggtggttgctaaggct
ggtgcgaaagtggtcatcatgtttaatccagttattgctcgacctcagcatcctagctcg
ctcatctttcctcattttggttttggacaagcttttacagaggaagagttagctaacttt
gaaaaattgccaatcgaagacttgatggagactttctttgaacgtgcactagcgagagca
aatcaagctggaattgcacaagaaaatatcctgttggatctaggaattggctttggtctg
accaagaaagaaaatctgcttcttttacgggatctggataaactacatcagaaaggctat
ccaatctttcttggagtgtcgcgcaagcggtttgtcatcaatatccttgaagaaaatggt
tttgaagtcaatcctgagacagaacttggtttccgtaatcgggacacggcttcggctcat
gtaactagtatcgctgcgagacagggtgtagaagtggtgcgcgtgcatgacgtagctaat
cacaggatggcagttgaaattgcttccgctattcgtctggctgatgaagcggaaaattta
gatttaaaacaatacaaataa

DBGET integrated database retrieval system