KEGG   Streptococcus pseudopneumoniae: SPPN_03395Help
Entry
SPPN_03395        CDS       T01590                                 

Definition
beta-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
std  Streptococcus pseudopneumoniae
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:std00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SPPN_03395
  Lipid metabolism
   00600 Sphingolipid metabolism
    SPPN_03395
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SPPN_03395
Enzymes [BR:std01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     SPPN_03395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
633570..640271
Genome map
AA seq 2233 aa AA seqDB search
MGKGHWNRKRVYSIRKFAVGACSVMIGTCAVLLGGNIAGESVVYADEILITHTAEKPKEE
KTIVEEKADKALETKNVVERTEQSESSSTEAIASEKKEDEAVTPKEEKVSAKPEEKAPRI
ESQASSQEKPLREDAKAVTNEEVNQMIEDRKVDFNQNWHFKLNANSKEVIKPDADVSTWK
KLDLPYDWSIFNDFDHESPAQNEGGQLNGGEAWYRKTFKLDEKDLTKNVRLTFDGVYMDS
QVYVNGQLVGHYPNGYNQFSYDITNYLNKDGRENVIAVHAVNKQPSSRWYSGSGIYRDVT
LQVTDKVHVEKNGTTILTPKLEEQQHGKVETHVTSKIVNTDDKDHELVAEYQIVERGGQA
VTGLVRTESRTLKAHESTSLDAILEVERPKLWTVLNDKPALYELITRVYRDGQLVDAKKD
LFGYRYYHWTPNEGFSLNGERIKFHGVSLHHDHGALGAEENYKAEYRRLKQMKEMGVNSI
RTTHNPASEQTLQIAAELGLLVQEEAFDTWYGGKKPYDYGRFFEKDATHPEARKGEKWSD
FDLRTMVERGKNNPAIFMWSIGNEIGEANGDAHSLATVKRLVKVIKDVDKTRYVTMGADK
FRFGNGSGGHEKIADELDAVGFNYSEDNYKALRAKHPKWLIYGSETSSATRTRGSYYRPE
RELKHSNGPERHYEQSDYGNDRVGWGKTATASWTFDRDNAGYAGQFIWTGTDYIGEPTPW
HNQNQTPVKSSYFGIVDTAGIPKHDFYLYQSQWVSVKKKPMVHLLPHWNWENKELASKVA
DSEGKIPVRAYSNASSVELFLNGKSLGLKTFNKKQTSDGRTYQEGANAKELYLEWKVTYQ
PGTLEAVARDEAGKEIARDKITTAGQPAGVRLVKEEHAIAADGKDLTYIYYEIVDSEGNV
VPTANNLVRFQLHGQGQLVGVDNGEQASRERYKAQADGSWIRRAFNGKGVAIVKSTEQAG
KFTLTAHSDLLKSDQVTVFTGKKEGQEKTVLGTEVARVRTLIGKEPKMPKTVGFVYSDGS
REKLPVTWSQVDVSQAGVVTVKGTANGREVEAHVEVLAIAKELPTVKRIAPNTNLNSVDK
SVSYVLTDGSVQEYEVDKWEIAEEDKAKLAIPGSRIQATGYLEGQPIHATLVVEEGNAAA
PVVPTVTVGGEAVTGLTSRQPMQYRTLSYGAQLPEVTASAENADVTVLQASAANGMRASI
FIQPKDGGPLQTYAIQFLEEAPKIAHLSLQVEKADSLKEDQTVKLSVRAHYQDGTQAVLP
ADKVTFSTSGEGEVAIRKGMLELHKPGAVTLKAEYEGAKGQVDLTIQANTEKKIAQSIRP
VNVVTDLHQEPTLPSTVTVEYDKGFPKAHKVTWQAIPKEKLDSYQTFEVLGKVEGIDLEA
RARVSVEGIVSVEEVSVTTPIAEAPQLPESVRTYDSNGHVSSAKVAWDAIRPEQYAKEGV
FTVNGRLEGTRLTTKLHVRVSAQTEQGANISDQWTGSELPLAFASDSNPSDPVSNVNDKL
ISYNNQPANRWTNWNRSNPEASVGVLFGDSGILSKRSVDNLSVGFHEDHGVGAPKSYVIE
YYVGKTVPTAPKNPSFVGNEDHVFNDSANWKPVTNLKAPAKLKAGEMNHFSFDKVETYAV
RIRMVKADNKRGTSITEVQIFAKQVAAAKQGQTRIQVDGKDLANFNPDLTDYYLESVDGK
VPAVTASVSNNGLATVVPSVREGEPVRVIAKAENGDILGEYRLHFTKDKNLLSYKPVAAV
KQARLVQVGQALELPTKVPVYFTGKDGYETKDLSVEWEEVQAENLTKAGQFTVRGHVLGS
DLVAEFTVRVTDKLGEALSDNPEYDEDSNQAFASATNDIDRNSHDRVDYLNDGDHSENRR
WTNWSARPSTNPEVSAGVIFRENGKIVERTVAQGKVQFFVDSGTDAPSKLVLERYVGPDF
EVPTYYSNYQAYESGHPFNNPENWEAVPYRADKDIAAGDEINVTFKAIKAKAMRWRMERK
ADKSGVAMIELTFLAPSELPQESTQSKILVDGKELADFAEDRQDYQITYKGQRPKVSVEE
NNQVASTVVDSGEDSLPVLVRLVSESGKQVKEYRIQLTKEKPVSEKTVAAVQEDFPKLEF
VEKDLAYKTVEKKDSTLYLGETRVEQEGKTGKERIFTAINPDGSKEEKLREVVEAPTDRI
ILVGTKPVAQEAKKPQVSEKADTKPIDSSEASQTNKAQLPNTGSAASQAAVAAGLALLGL
SAGLVVTKGKKED
NT seq 6702 nt NT seq  +upstreamnt  +downstreamnt
atggggaaaggccattggaatcggaaaagagtttatagcattcgtaagtttgctgtggga
gcttgctcagtaatgattgggacttgtgcagttctattaggaggaaatatagctggagaa
tctgtagtttatgcggatgaaatacttattactcatactgctgagaaacctaaagaggaa
aaaacgatagtagaagaaaaggctgataaagctttggaaactaaaaatgtagttgaaagg
acagaacaaagtgaatctagttcaactgaggctattgcatctgagaagaaagaagatgaa
gccgtaactccaaaagaggaaaaagtgtctgctaaaccggaagaaaaagctccaaggata
gaatcacaagcttcaagtcaagaaaaaccgcttagggaagatgctaaagctgtaacaaat
gaagaagtgaatcaaatgattgaagacaggaaagtggattttaatcaaaattggcacttt
aaactcaatgcaaattctaaggaagtcattaaaccggatgcagatgtatctacgtggaaa
aaattggatttaccgtatgactggagtatttttaatgatttcgatcatgaatctcctgca
caaaatgaaggtggacagcttaacggtggggaagcttggtatcgcaagactttcaaacta
gatgaaaaagacctcacgaaaaatgttcgccttacttttgatggcgtctacatggattct
caagtttatgtcaatggtcagttagtggggcattatccaaatggttataaccaattttca
tatgatatcactaactatttgaacaaagatggtcgtgagaatgtgattgctgtccatgca
gtcaacaaacagccaagtagccgttggtattcaggaagtggtatctatcgtgatgtgact
ttacaagtgacagataaggtgcatgttgagaaaaatgggacaactattttaacaccaaaa
cttgaagaacaacaacatggcaaggttgaaactcatgtgaccagcaaaatcgtcaatacg
gacgacaaagaccatgaacttgtagcagaatatcaaatcgttgaacgtggtggtcaggct
gtgacaggtctagtacgtacagagagtcgtaccttaaaagcacatgaatcaacaagccta
gatgcgattttagaagttgaaagaccaaaactctggaccgttttaaatgacaaacctgcc
ttgtacgaattgattacgcgtgtttaccgtgacggtcaattggttgatgctaagaaggat
ttgtttggttaccgttactatcactggactccaaatgaaggtttctctttgaatggtgaa
cgtattaaattccatggagtatccttgcaccacgaccatggggcgcttggagcagaagaa
aactataaagcagaataccgtcgtctcaaacaaatgaaggagatgggagttaactccatc
cgtacaacccacaaccctgctagtgagcaaaccttgcaaatcgcagcagaactaggttta
ctcgttcaggaagaggcctttgatacttggtatggtggcaagaaaccttatgactatgga
cgtttctttgaaaaagatgccactcacccagaagctcgaaaaggtgaaaaatggtctgat
tttgacctacgtaccatggtcgaaagaggcaaaaacaaccctgctatcttcatgtggtca
attggtaatgaaataggtgaagctaatggtgatgcccactctttagcaactgttaaacgt
ttggtcaaggttatcaaggatgttgataagactcgctatgttaccatgggagcagataaa
ttccgtttcggtaatggtagcggagggcatgagaaaattgctgatgaactcgatgctgtt
ggatttaactattctgaagataattacaaagcccttagagctaagcatccaaaatggttg
atttatggatcagaaacatcttcagctacccgtacacgtggaagttactatcgccctgaa
cgtgaattgaaacatagcaatggacctgagcgtcattatgaacagtctgactatgggaat
gatcgtgtgggttgggggaaaacagcaaccgcttcatggacttttgaccgtgacaacgct
ggctatgctggacagtttatctggacaggtacggactatattggtgaacctacaccatgg
cacaaccaaaatcaaactcctgttaagagctcttactttggtatcgtagatacagccggc
attccaaaacatgacttctatctctaccaaagccaatgggtttctgttaagaagaaaccg
atggtacaccttcttcctcactggaactgggaaaacaaagaattagcatccaaagtagct
gactcagaaggtaagattccagttcgtgcttattcgaatgcttctagtgtagaattgttc
ttgaatggaaaatctcttggtcttaagaccttcaacaaaaaacaaaccagcgatggtcgt
acctaccaagaaggtgcgaatgctaaggaactctatcttgagtggaaggttacttaccaa
ccaggtaccttggaagctgtagctcgcgatgaagctggaaaagaaattgcacgtgacaag
attaccactgcagggcaaccagcaggagttcgcctcgtcaaggaagaacacgccatcgcc
gcagatggaaaagacttgacttacatctactacgaaatcgtagacagtgaaggaaatgtt
gtaccaactgccaataatttggttcgtttccaattgcatggacaaggtcaactagtcggt
gtcgataatggggaacaagccagccgagaacgctataaggcgcaagcagatggttcatgg
atccgtagagcctttaacggtaaaggggttgccatcgttaaatcaactgaacaagcaggt
aaattcactctgactgcccactcagatctcttgaaatcggaccaagttaccgtctttact
ggtaagaaagaaggacaagagaagactgttttggggacagaagtagcaagagttcgtaca
ttaattggtaaagaaccaaaaatgccgaaaacagtaggttttgtatacagcgacggtagt
cgtgaaaaacttccagtaacttggtctcaagtcgatgttagtcaagcaggagttgtgact
gttaaaggtacagcaaatggacgtgaggtagaggctcatgtcgaggttctagcaattgcg
aaagaattaccaacagttaaacgtattgctccaaatactaacttgaattctgtagacaaa
tctgtttcctatgttttgactgatggaagtgtacaagagtatgaagtggacaagtgggag
attgccgaagaagataaagctaagttagcaattccaggttctcgtattcaagcgaccggt
tatttagaaggtcaaccaattcatgcaacccttgtggtagaagaaggaaatgctgcagca
cctgtagtgccaactgttactgttggaggtgaggcagtaacaggtcttactagtcgacaa
ccaatgcaatatcgtactctatcttatggtgcccaactgccagaagtcacagcaagtgct
gaaaatgctgatgtgacagttcttcaagcaagcgcagcaaacggcatgcgtgcgagcatc
tttattcagcctaaagatggtggccctcttcaaacctatgcaattcaattccttgaagaa
gcaccaaaaattgctcacttgagcttgcaagtggaaaaagctgacagtctcaaagaagac
caaactgtcaaattgtcggttcgagctcactatcaagatggaacgcaagctgtattacca
gctgataaagtaaccttttctacaagtggtgaaggggaagtcgcaattcgtaaaggaatg
cttgagttacataagccaggagcagtcactctcaaagcggaatatgagggagctaaaggc
caagttgatctcactatccaggccaatactgagaagaagattgcgcaatctatccgtcca
gtaaatgtagtgacagatttacaccaagaacctactcttccgtcaacagtaacggttgag
tatgacaaaggtttccctaaagctcacaaagtcacttggcaagctattccgaaagaaaaa
ctagactcctatcaaacctttgaagtgttaggtaaagttgaaggaattgaccttgaagcg
cgtgcaagagtctctgtagaaggtatcgtttcagttgaagaagtcagtgtgacaactcca
atcgcagaagcaccacaattaccagaaagcgttcggacatatgattcaaatggtcacgtt
tcatcagctaaggttgcatgggatgcgattcgtccagagcaatacgctaaggaaggtgtc
tttacagttaatggtcgcttagaaggtacgcgattaacaactaaacttcatgttcgcgta
tctgctcaaactgagcaaggtgcaaacatttctgaccaatggaccggttcagaattgcca
cttgcctttgcttcagattcaaatccaagcgacccagtttcaaatgttaatgacaagctc
atttcctacaataaccaaccagccaatcgttggacaaactggaatcgtagtaatccagaa
gcttcagtcggtgttctgtttggagattcaggtatcttgagcaaacgctccgttgataat
ctaagtgtcggattccacgaagaccatggagttggtgcaccgaagtcttatgtgattgag
tattatgttggcaagactgtcccaacagctcctaaaaaccctagttttgttggtaatgag
gaccatgtctttaatgattctgccaactggaaaccagttactaatctaaaagcccctgct
aaactcaaggctggagaaatgaaccactttagctttgataaagttgaaacctatgctgtt
cgtattcgcatggttaaagcagataacaagcgtggaacgtctatcacagaggtacaaatc
tttgcgaaacaagttgcggcagccaaacaaggacaaacaagaatccaagttgacggcaaa
gacttagcaaacttcaaccctgatttgacagactactaccttgagtctgtagatggaaaa
gttccggcagtcacagcaagtgttagcaacaatggtctcgctaccgtcgttccaagcgtt
cgtgaaggtgagccagttcgtgtcatcgcgaaagctgaaaatggcgacatcttaggagaa
taccgtctgcacttcactaaggataagaacttactttcttataaaccagttgctgcggtt
aaacaagctcgcttggtacaagtaggtcaagcacttgaattgccgactaaggttccagtt
tacttcacaggtaaagacggctacgaaacaaaagacttgtcagttgaatgggaagaagtt
caagcagaaaatctgacaaaagcaggtcaatttaccgttcgaggccatgtccttggtagt
gatcttgttgctgagttcactgtacgagtgacagacaaactaggcgaagctctttcagat
aacccagagtatgatgaagacagtaaccaggcctttgcttcagccactaacgatattgat
agaaactcccatgaccgtgtggattatctcaatgacggagatcattcagaaaatcgtcgt
tggacaaactggtctgcaagaccgtctaccaatccagaagtatcagcaggcgtaatcttc
cgtgaaaatggtaagattgtagaacggactgttgcacaaggaaaagttcagttctttgta
gatagtggtacagatgcaccatctaaacttgttttggaacgttatgtcggcccagacttt
gaagtgcctacctactattcaaactaccaagcctacgaatctggacatccatttaacaat
ccagaaaattgggaagctgtgccttatcgtgcggataaagacattgcagctggtgatgaa
atcaacgtaacatttaaagctatcaaagccaaagctatgagatggcgtatggagcgtaaa
gcagataagagcggtgttgcgatgattgagctgaccttccttgcaccaagcgaattgcct
caagaaagcactcaatcgaagattcttgtagatggaaaagaacttgctgatttcgctgaa
gatcgtcaagactaccaaatcacctataaaggtcaacggccaaaagtctcagttgaagaa
aacaatcaagtagcttcgactgtggtagatagtggagaagatagtcttccagtacttgtt
cgcctcgtttcagaaagtggaaaacaagtcaaggaataccgtatccagttgactaaggaa
aaaccagtttctgagaagacagttgctgctgtacaagaagattttccaaaactcgaattt
gttgaaaaagatttggcatacaagacagttgagaaaaaagattcaacactgtatctaggt
gaaactcgtgtagaacaagaaggaaaaactggtaaagaacgtatctttacagcgattaat
cctgatggaagtaaggaagaaaaactccgtgaagtggtagaagctccgacagaccgcatc
atcttggttggaaccaaaccagtagctcaagaagctaaaaaaccacaagtgtcagaaaaa
gcagatacaaaaccaattgattcaagtgaagctagtcaaactaataaagcccagttacca
aatacaggtagtgcggcaagccaagcagcagtagcagcaggtttagctcttctaggtttg
agtgcaggattagtagttactaaaggtaaaaaagaagactag

DBGET integrated database retrieval system