KEGG   Streptococcus pseudopneumoniae: SPPN_03745Help
Entry
SPPN_03745        CDS       T01590                                 

Definition
phospho-beta-gluco or galactosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
std  Streptococcus pseudopneumoniae
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:std00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPPN_03745
Enzymes [BR:std01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     SPPN_03745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
714574..714870
Genome map
AA seq 98 aa AA seqDB search
MDKPDENGYVADDYRITYLEAHIKAMRDAIYQDGVDLLGYTTWRCIDPVSAGTGEMNKRY
GFIYVDRDNVGNGTLKRSKKKSFYWYKDVIDSNGASIE
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atggataaaccggatgagaatggttatgtagcagatgactatcggattacttacttagag
gcccacatcaaggccatgcgagatgccatttaccaagacggggttgacttgcttggttat
acgacttggagatgtatcgatccggtttcagctggcacaggggaaatgaataagcgctat
ggctttatctatgtagatcgagataatgtaggaaatgggactctcaaacgtagcaagaag
aagtccttctattggtacaaggatgtcattgatagcaatggagcaagcatcgagtag

DBGET integrated database retrieval system