KEGG   Streptococcus pseudopneumoniae: SPPN_04535Help
Entry
SPPN_04535        CDS       T01590                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
std  Streptococcus pseudopneumoniae
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:std00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SPPN_04535
   01230 Biosynthesis of amino acids
    SPPN_04535
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPPN_04535
   00030 Pentose phosphate pathway
    SPPN_04535
   00051 Fructose and mannose metabolism
    SPPN_04535
   00052 Galactose metabolism
    SPPN_04535
  Energy metabolism
   00680 Methane metabolism
    SPPN_04535
Enzymes [BR:std01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SPPN_04535
Protein phosphatases and associated proteins [BR:std01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SPPN_04535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
879030..880037
Genome map
AA seq 335 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAIRAVVRQAISEGMEVFGIYDGYAGMVAGEIHPLDAASVGDI
ISRGGTFLHSARYPEFAQLEGQLKGIEQLKKHGIEGVVVIGGDGSYHGAMRLTEHGFPAI
GLPGTIDNDIVGTDFTIGFDTAVTTAMDAIDKIRDTSSSHRRTFVIEVMGRNAGDIALWA
GIATGADEIIIPEEGFKIEDIVESIKCGYECGKKHNIIVLAEGVMSAAEFGQKLKEAGDT
SDLRVTELGHIQRGGSPTARDRVLASRMGAHAVKLLKEGIGGVAVGIRNEKMVENPILGT
AEEGALFSLTAEGKIVVNNPHKADIELSSLNKSLS
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgctgttttgactagtggtggagacgcccctggtatgaacgctgctatc
cgtgcagttgttcgtcaagcaatttcagaaggaatggaagtgtttggtatctatgacgga
tatgctggtatggttgccggtgaaattcatcccctagatgcagcttcagtaggagacatc
atttctcgtggtggtactttccttcactcagctcgttacccagagttcgctcaacttgaa
gggcaactaaaagggattgagcaattgaaaaaacacggcattgaaggtgtagttgttatc
ggtggagacggttcttaccacggcgctatgcgtttgactgagcatggtttccctgctatc
ggtcttccaggtacaatcgataacgatatcgttggtactgactttacaatcggttttgac
acagcggttacaactgctatggatgctattgataagattcgtgatacatcatcaagtcac
cgtcgtacttttgttattgaagttatgggacgtaacgctggtgatatcgctctttgggct
ggtattgcaactggtgcagatgaaatcatcattcctgaggaaggattcaagattgaagac
atcgtagaaagcattaaatgtggttatgagtgtggtaaaaaacacaatatcatcgtctta
gctgaaggtgtgatgtcagcagctgaatttggtcaaaaacttaaagaagctggagataca
agcgaccttcgtgtgacagaacttggacatattcaacgtggtggttctccaactgcgcgt
gaccgtgtattggcgtcacgtatgggtgcccatgctgttaaacttcttaaagaaggtatt
ggtggtgttgcggttggtatccgtaacgagaaaatggttgaaaacccaattcttggaacg
gcagaagaaggagcattgtttagccttactgcagaaggtaagattgtagttaacaaccca
cacaaagccgatattgagctatctagcttgaataagagcttgtcataa

DBGET integrated database retrieval system