KEGG   Streptococcus pseudopneumoniae: SPPN_05560Help
Entry
SPPN_05560        CDS       T01590                                 

Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
std  Streptococcus pseudopneumoniae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:std00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SPPN_05560
Enzymes [BR:std01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     SPPN_05560
Exosome [BR:std04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SPPN_05560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1044047..1045975
Genome map
AA seq 642 aa AA seqDB search
MDRREALRTFMTGENFHLQHYLGAHREEKDGESGYTFRVWAPNAQAVHLVGDFTNWVENQ
IPMERNEFGVWEVFTSFAQEGQIYKYHITRANGHQLMKIDPLAVRYEARPGTGAILTEIP
EKKWKDRLWLARRKRLSFEERPVNIYEVHAGSWKRNPDGSPYSFAQLKDELIPYLVEMNY
THIEFMPLMSHPLGLSWGYQLMGYFALEHAYGRPEEFQDFVEECHLNNIGIIVDWVPGHF
TINDDALAYYDGTPTFEYQDHNKAHNYGWGALNFDLGKNEVQSFLISSIKFWIDFYHLDG
IRVDAVSNMLYLDYDDAPWTPNKDGGNLNYEGYYFLQRLNDVIKLAHPDVMMIAEESSSA
TQITDTKDSDGLGFDYKWNMGWMNDILRFYEEDPIYRTYDFNLVTFSFMYVFKENYLLPF
SHDEVVHGKKSMMHKMWGDRYNQFAGLRNLYTYQICHPGKKLLFMGSEYGQFLEWRSEEQ
LEWSNLEDPMNAKMKYFTSQLNQFYKDHRCLWEIDTSYDGIEIIDADNRDQSVLSFIRKG
KKGDMLVCVFNMAPVERKDFTIGLPVAGIYEEVWNTELEEWGGVWKEHNQTVQTQEGLWK
DYEQTLTFTLPAMGASVWKIKRRLKSDKTVTSKNQKGVENEE
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atggatagaagagaagcattgcgcacctttatgacaggtgagaattttcacctccagcat
tatctgggagcgcatagggaagaaaaagatggtgagtctggctatactttccgagtttgg
gcacccaatgctcaggcagttcacttggtaggggattttaccaattgggtagaaaatcag
attccgatggaacggaatgaatttggagtctgggaagtctttaccagttttgctcaagaa
ggccaaatttacaagtaccatatcacacgtgcaaatggtcatcagcttatgaagattgat
cctttggctgtacggtatgaggcacgacctggtactggagcgattttaacagagattcca
gagaaaaaatggaaggatagactctggctagcccgtagaaaacgcttaagctttgaagag
cgtcctgtcaatatttacgaggttcatgctggctcttggaagagaaatccagacggtagt
ccctatagttttgctcaattgaaagatgaactcattccttacctagttgagatgaactat
actcacattgagtttatgcccttgatgtctcaccctctcggtttgagttggggctatcag
cttatgggttactttgctttagagcatgcctatggtcgtcctgaagagtttcaagatttt
gttgaggaatgtcacttaaacaatattgggattattgtggactgggtacctggtcacttc
actattaatgatgatgccttagcctattacgatgggacaccgacttttgagtatcaggac
cataataaggctcataactatggttggggagcactcaatttcgaccttgggaagaatgaa
gtccagtccttcttgatttctagcattaagttttggattgacttttaccatttggacggt
attcgcgtggatgcggttagcaacatgctctatctagattacgatgatgccccatggaca
ccgaataaagatggcggtaatctcaactatgaaggatattatttccttcaacgcttgaat
gatgtcattaaactagctcatccagatgtgatgatgatagctgaggaaagttcatcagct
actcagattactgatacaaaggattcagatggtcttggctttgactacaaatggaatatg
ggctggatgaatgatattctccgtttctatgaagaagatccgatttatcgtacatacgac
tttaacctagtgactttcagctttatgtatgtcttcaaggagaattatctcctaccattc
tcacacgatgaagttgttcatggcaagaagagtatgatgcacaagatgtggggagatcgc
tataatcaattcgcaggcttgcgcaatctctatacgtaccaaatttgtcaccctggtaag
aaattgctcttcatgggtagtgaatacggccaattcctagaatggagatctgaagagcag
ttggaatggtctaatctagaagaccctatgaatgctaagatgaagtatttcacttctcag
ctaaaccagttttacaaagatcatcgctgtctgtgggaaatcgataccagctatgatggt
attgaaatcattgatgcggataatcgagaccagagtgttctttccttcatccgtaagggt
aagaagggcgacatgctagtctgcgtctttaatatggcacctgttgaacgaaaagatttt
acaatcggtctgcctgttgcagggatttatgaagaagtctggaatactgagttagaagag
tggggaggcgtttggaaagaacataatcaaactgttcaaacgcaagaaggactatggaaa
gattatgagcagaccttgacctttaccctaccggctatgggagcaagtgtttggaaaatc
aaacgccgcttgaaatctgataaaactgtcacaagtaaaaaccaaaaaggagtagaaaat
gaagaatga

DBGET integrated database retrieval system