KEGG   Streptococcus pseudopneumoniae: SPPN_06010Help
Entry
SPPN_06010        CDS       T01590                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
std  Streptococcus pseudopneumoniae
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:std00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SPPN_06010
Enzymes [BR:std01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     SPPN_06010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1144777..1145688)
Genome map
AA seq 303 aa AA seqDB search
MSKIVVVGSISMDLVMRTKRIPEGGETIFGDSFNIVPGGKGANQAVAIGRLSSVEDNIYI
FGNVGEDIFSADLLSNLQNNNISTEYVGTVPQYTGAAQITLYGGDNRIIYYPGANNLVKT
NDWKNEWELISDASIVVLQNEIPHEANLSIAKFCQENQVKVLYNPAPARETDIEMIPFCD
FMTPNEHECSELFPDKKLEEIIKIYPNKMIVTLGVEGSIYYDGTVVQKIPAIKAEVVDTT
GAGDTFNGAFAYAISKGKEMNVALSFATIASHLSVQRFGAQGGMPSLKEIKEHSGYEEIW
DFK
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaattgttgttgttggaagtatttcaatggacttagttatgagaacaaaaagg
attccagaaggaggtgaaacgatttttggggattcgtttaatatagttccaggtggaaaa
ggtgcaaatcaagctgtagctattggtagattatccagtgtagaagataatatttacata
tttggaaatgtcggagaagatattttttcagcagatttattaagtaatctgcaaaataat
aatatttctacagaatatgtgggaacggtaccacaatatacaggagctgcacaaattact
ttatatggaggtgataataggattatttattatcccggagcgaataatttagttaaaaca
aatgattggaaaaatgagtgggaattaattagtgatgcaagtattgttgtattacagaat
gaaataccacatgaagccaacctatctatagctaaattttgtcaagaaaatcaagttaag
gtactttacaatcctgcaccagctagagaaacagacatagagatgattcctttttgtgat
tttatgactcctaatgagcatgaatgttcagagctttttccagataagaaattagaagaa
attattaaaatttatcctaataaaatgattgtgacattaggagttgaaggttctatttat
tatgatgggacagtagttcagaagattcctgctataaaagcagaagtagttgatactaca
ggagcaggagatacgtttaatggtgcttttgcttatgctatctcaaaaggaaaagagatg
aatgttgcattgtcctttgcaacgattgcttcacatctttctgttcaaagatttggagcg
caaggaggcatgccgagtttgaaagaaataaaggagcattcaggatatgaagaaatatgg
gattttaaatag

DBGET integrated database retrieval system