KEGG   Streptococcus pseudopneumoniae: SPPN_06160Help
Entry
SPPN_06160        CDS       T01590                                 

Gene name
rnc
Definition
ribonuclease III (EC:3.1.26.3)
Orthology
K03685  
ribonuclease III [EC:3.1.26.3]
Organism
std  Streptococcus pseudopneumoniae
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1175073..1175771)
Genome map
AA seq 232 aa AA seqDB search
MKELQTVLKNHFAIEFADKNLLETAFTHTSYANEHRLLKISHNERLEFLGDAVLQLLISE
YLYKKYPKKPEGDLSKLRAMIVREESLAGFARDCQFDQFIKLGKGEEKSGGRNRDTILGD
AFEAFLGALLLDKDVTKVKEFIYQVMIPKVEAGEFEMITDYKTHLQELLQVNGDVAIRYQ
VISETGPAHDKVFDVEVLVEGKSIGQGQGRSKKLAEQEAAKNAVEKGLDSCI
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaattacaaactgtactaaagaaccattttgcaatcgaatttgcagacaaaaat
ttactggaaactgcctttactcatacgagttatgccaatgagcaccgcctcttaaaaatt
tcacacaatgaacgcttggaatttttaggagacgctgttctacagttattgatttcagaa
tatctgtataaaaaatatcctaaaaagcctgagggtgacctgtctaaactccgtgccatg
attgtccgcgaggaaagtttggctggttttgcgcgtgattgccagtttgatcagtttatc
aagcttggtaagggggaagaaaagtctggtggtcgcaatcgtgataccattcttggtgat
gcctttgaagcctttcttggtgccctccttttggataaggacgtgaccaaggtcaaggaa
tttatctatcaagtcatgattcctaaggttgaagcaggagagtttgagatgattacagac
tacaaaacccatctccaagagttacttcaggtcaatggcgatgtggctatccgttatcag
gtgatttctgaaacgggtcctgcccacgataaggtctttgatgtagaagttcttgttgaa
ggcaagagcattggtcaaggtcaaggtcgttcgaaaaaattagcagagcaggaagctgcc
aaaaatgccgttgagaaagggctggattcatgtatttaa

DBGET integrated database retrieval system