KEGG   Streptococcus pseudopneumoniae: SPPN_06610Help
Entry
SPPN_06610        CDS       T01590                                 

Definition
(GenBank) gamma-glutamyl kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
std  Streptococcus pseudopneumoniae
Pathway
std00330  Arginine and proline metabolism
std00332  Carbapenem biosynthesis
std01100  Metabolic pathways
std01130  Biosynthesis of antibiotics
std01230  Biosynthesis of amino acids
Module
std_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:std00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SPPN_06610
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    SPPN_06610
Enzymes [BR:std01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     SPPN_06610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA FliC
Motif
Other DBs
NCBI-ProteinID: AEL10754
UniProt: G0IA81
Position
complement(1260862..1261971)
Genome map
AA seq 369 aa AA seqDB search
MKYKRIVFKVGTSSLTNEDGSLSRSKVKAITQQLAMLHEAGHELILVSSGAIAAGFGALG
FKKRPTKIADKQASAAVGQGLLLEEYTTNLLLRQIVSAQILLTQDDFVDKRRYKNAHQAL
SVLLSRGAIPIINENDSVVIDELKVGDNDTLSAQVAAMVQADLLILLTDVDGLYTGNPNS
DPRAKRLEQIETINREIIDMAGGAGSSNGTGGMLTKIKAATIATESGVPVYICSSLKSDA
MIEAAEETKDGSYFVAQEKGLRTQKQWLAFYAQSQGSIWVDKGAAEALSQHGKSLLLSGI
VEAEGAFSYGDIVTVFDKESGKSLGKGRVQFGASALEDMLRSQKAKGVLIYRDDWISITP
EIQLLFTEF
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacaaacggattgtctttaaggtgggtacttcttctctgacaaatgaggatgga
agtttatcacgtagtaaggtaaaggctattacccagcagttggctatgctgcacgaggct
ggtcatgagttgattttggtgtcttcaggtgccattgcggctggttttggagccttagga
tttaaaaagcgtccgactaaaattgctgataaacaggcttcagcagcggtaggacaaggg
cttttgttggaagaatacacgaccaatcttctcttgcgccaaatcgtttctgcacaaatc
ttgctaacccaggatgactttgtagataagcgtcgttataaaaatgcccatcaggctttg
tcggttttacttagccgtggggcgattcctatcatcaatgagaatgatagtgttgttatt
gatgagctcaaggttggggacaatgatactctgagtgcacaggtggcggccatggtccaa
gcagaccttttgatcctcttgacagacgtagatggtctctatacaggaaatcctaattca
gatccaagagccaaacgtttggagcaaatcgagactatcaatcgtgagattatcgatatg
gccggtggagctggttcgtcaaacggaactgggggcatgttaaccaaaatcaaagctgca
actattgcgacagaatcgggtgttcctgtttatatctgctcatccttgaagtcagatgcc
atgattgaagcggctgaggagaccaaggatggttcctactttgttgcgcaagagaagggg
cttcgtacccagaaacaatggctggccttttatgctcagagtcaaggttctatttgggtt
gataaaggggctgcggaagctctctctcaacatggaaagagtcttctcttatctggtatc
gttgaagcagaaggagccttttcttacggtgatatcgtgacagtatttgataaggaaagt
ggaaaatcacttggaaaaggacgcgtgcaatttggagcatctgctttggaggatatgttg
cgttctcaaaaagccaagggtgtcttgatttaccgtgacgactggatttccattactcct
gaaatccaactactttttacagaattttag

DBGET integrated database retrieval system