KEGG   Streptococcus pseudopneumoniae: SPPN_08535Help
Entry
SPPN_08535        CDS       T01590                                 

Definition
(GenBank) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
std  Streptococcus pseudopneumoniae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:std00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SPPN_08535
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SPPN_08535
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SPPN_08535
Enzymes [BR:std01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SPPN_08535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1646483..1647706)
Genome map
AA seq 407 aa AA seqDB search
MAYQEPNKDGFYGKFGGRFVPEILMTAVLELEKAYCESQADPSFQEELNQLLRQYVGRET
PLYYAKNLTQHIGGAKIYLKREDLNHTGAHKINNVLGQVWLAKRMGKKKIIAETGAGQHG
VATATAAALFNMECTIYMGEEDVKRQALNVFRMELLGAKVEAVTDGSRVLKDAVNAALRS
WVANIDDTHYILGSALGPHPFPEIVRDFQSVIGREAKQQYRDMTGQNLPDALVACVGGGS
NAIGLFHPFVEDESVAMYGAEAAGLGVDTEHHAATLTKGRPGVLHGSLMDVLQDAHGQIL
EAFSISAGLDYPGIGPEHSHYHDIKRASYVPVTDEEALEGFQLLSRVEGIIPALESSHAI
AFAVKLAKELGPDKSMIVCLSGRGDKDVVQVKDRLEADAAKKGEAHA
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggcatatcaggaaccaaataaagatggattttacggaaaattcggcggacgttttgtc
ccagaaatattgatgacagcagttttggagttggagaaggcctactgtgaaagtcaggca
gacccaagtttccaagaggaattaaaccagcttttgcgccagtacgtaggacgtgaaact
cctctttattacgcaaaaaacttgacccagcatatcggcggagccaagatttatctcaaa
cgggaagaccttaaccatacaggagcccacaagattaacaatgtcttaggacaagtttgg
cttgccaaacgcatgggtaaaaagaaaattatcgcagaaacgggtgctggtcagcacggt
gtggcaactgcaactgctgcggccctctttaacatggaatgtaccatctacatgggtgag
gaagatgtcaaacgccaagccctcaatgtcttccgcatggagcttttgggagccaaggtc
gaggctgtaacagatggttcgcgcgtgctcaaggatgcggtcaatgcagcccttcgttca
tgggtggctaatatcgacgatacccactatatccttggttctgccttggggcctcatcca
tttccagaaatcgttcgtgacttccaaagtgtcatcggtcgcgaagctaaacaacagtat
cgcgatatgacaggtcaaaatctgcccgatgccctagtagcctgtgttggtggtggatct
aatgctattgggctcttccatccctttgtagaagatgagtctgtagctatgtatggagct
gaagcggctggacttggtgtggatacagagcaccacgcagctaccttgaccaagggtcgt
ccaggtgtccttcacggttccctcatggatgtgctccaagatgcccatggtcaaattctt
gaagccttctctatctcagcaggtttggactatcctggtatcggtccagagcattctcac
taccacgatattaaacgtgccagctatgtccctgtaacagacgaagaagccttggaagga
ttccaactcttgtctcgtgtggaagggattatcccagccttggaatcgagtcatgctatc
gcctttgcggtgaaattggccaaagaacttggaccagacaagtctatgattgtctgtcta
tcaggtcgtggggacaaggatgtggttcaagtcaaggaccgcttggaagcagatgcagca
aagaagggagaagctcatgcctaa

DBGET integrated database retrieval system