KEGG   Streptococcus pseudopneumoniae: SPPN_09920Help
Entry
SPPN_09920        CDS       T01590                                 

Definition
gluthatione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
std  Streptococcus pseudopneumoniae
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:std00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    SPPN_09920
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SPPN_09920
Enzymes [BR:std01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     SPPN_09920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1876090..1876566
Genome map
AA seq 158 aa AA seqDB search
MTSLYDFSVLNQDHQETPLDAYRGEVLLVVNTATGCGLTPQYQGLQELYDRYQEQGFEIL
DFPCNQFMGQAPGSAEEINAFCSLHYQTTFPRFAKIKVNGKEADPLYVWLKEQKSGPLGK
RIEWNFSKFLIGRDGQVFERFSSKTDPKQIEEAIQKLL
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgacttcactatacgatttttcagtcttaaaccaagaccatcaagaaaccccactagat
gcctatcgtggagaagttctcttggttgtcaacactgctactggatgtggtttaacgccc
cagtaccaaggacttcaagaactctatgatcgctatcaagaacaaggttttgagatttta
gacttcccttgcaatcagtttatgggacaagcaccaggtagcgcagaggaaatcaacgcc
ttctgtagcctacactatcaaaccactttcccacgttttgccaagatcaaggtcaacggt
aaggaggcagatcccctctatgtttggttgaaagaacaaaaatctggcccactaggaaaa
cgaatcgaatggaatttctctaaatttctcatcggtcgtgatgggcaggtctttgagcgc
ttctcttcaaaaacagacccaaaacaaattgaagaggcgatacaaaaattactataa

DBGET integrated database retrieval system