KEGG   Streptococcus pseudopneumoniae: SPPN_10360Help
Entry
SPPN_10360        CDS       T01590                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
std  Streptococcus pseudopneumoniae
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:std00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SPPN_10360
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPPN_10360
   00620 Pyruvate metabolism
    SPPN_10360
   00650 Butanoate metabolism
    SPPN_10360
  Lipid metabolism
   00071 Fatty acid degradation
    SPPN_10360
  Amino acid metabolism
   00350 Tyrosine metabolism
    SPPN_10360
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SPPN_10360
   00626 Naphthalene degradation
    SPPN_10360
Enzymes [BR:std01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SPPN_10360
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     SPPN_10360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1960668..1963319)
Genome map
AA seq 883 aa AA seqDB search
MADKKTVTPEEKKLAAEKHVDGLVQKALVALEEMRKLDQEQVDYIVAKASVAALDAHGEL
ALHAFEETGRGVFEDKATKNLFACEHVVNNMRHTKTVGVIEEDDVTGLTLIAEPVGVVCG
ITPTTNPTSTAIFKSLISLKTRNPIVFAFHPSAQESSAHAARIVRDAAIAAGAPENCVQW
ITEPSMEATSALMNHEGIATILATGGNAMVKAAYSCGKPALGVGAGNVPAYVEKSANIRQ
AAHDIVMSKSFDNGMVCASEQAVIIDKEIYDEFVAEFKSYHTYFVNKKEKALLEEFCFGV
KANSKNCAGAKLNADIVGKPATWIAEQAGFTVPEGTNILAAECKEVGENEPLTREKLSPV
IAVLKSESREDGITKARQMVEFNGLGHSAAIHTADDELTKEFGKAVKAIRVICNSPSTFG
GIGDVYNAFLPSLTLGCGSYGRNSVGDNVSAINLLNIKKVGRRRNNMQWFKVPSKIYFER
NSIQYLQTCEDIERVLIVTDKSIEKLGFVQRVIDQLNARSNRVTIQVFSDVEPDPDITTV
ERGAEVMKAFEPDTIIALGGGSPMDAAKVMWLFYEQPEIDFRDLVQKFMDIRKRAFRFPS
LGKKAKYIGIPTTSGTGSEVTPFAVISDKKNNRKYPLADYSLTPTIAIVDPALVESVPDF
IAADTGMDVLTHATEAYTSNFANDYTDGIALQTIKLVFEWLEKSVKTADPEAREKMHNAS
TMAGMAFANAFLGMSHSMAHKIGGVHHTVHGRTNAILLPYVIRYNGTRPAKTTTWPKYNY
WKADEKFQDIAKMLGLPHSTPEEAVEAYAKAVYELGVAVGIKMNFQDQGIDEKAWKDSLH
EIALLAYEDQCSPANPRLPMVADMEEIMADAYYGYKERPGRRK
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atggctgataaaaaaactgtgacaccagaggaaaagaaactcgctgctgaaaagcatgtc
gatggattggtgcaaaaagctctagttgctcttgaagaaatgcgtaagttggatcaagag
caggttgactacatcgttgccaaagcatcagtagcagctttggatgcccacggagaattg
gctttacatgcctttgaagaaacaggacgtggtgtatttgaagataaagcaactaagaac
ttgtttgcttgtgaacacgtagtaaacaacatgcgccacactaagacagttggcgttatc
gaagaagacgatgtaacaggattgactcttattgctgaaccagttggtgttgtttgtggt
attaccccaacaacaaacccaacatcaacagcaatcttcaaatcattgatttcattgaag
acacgtaatccaatcgtttttgccttccacccatcagcacaagaatcatctgctcatgca
gcacgtattgtccgcgatgcagctatcgcagctggtgctcctgaaaactgtgtacagtgg
attactgaaccatctatggaagcaactagtgcgcttatgaaccacgaaggtattgcgaca
attcttgcaacaggtggtaacgccatggtgaaggctgcgtactcatgtggtaaaccagct
cttggagtaggtgccggaaacgttccagcttatgttgaaaaatcagcaaatatccgtcaa
gcagcacacgatatcgtcatgtctaaatcatttgataacggtatggtctgtgcatctgaa
caagcggttatcattgacaaagaaatctacgatgaatttgtagcagagttcaaatcttac
cacacttactttgtaaataaaaaagaaaaagctcttcttgaagaattctgtttcggcgtc
aaagcaaacagcaaaaactgtgctggtgcaaaattgaacgctgacatcgttggtaaacca
gcaacttggattgcagagcaagcaggatttacagttccagaaggaacaaacattcttgct
gcagaatgtaaagaagttggcgaaaatgagccattgactcgtgagaaattgtcaccagtt
atcgcagttttgaaatctgaaagccgtgaagatggtattactaaggctcgtcaaatggtt
gaatttaacggtcttggccactcagcagccatccacacagctgacgacgaattgactaaa
gaatttggtaaagctgttaaagctattcgtgttatctgtaactcaccttctactttcggt
ggtatcggggacgtttacaatgccttcttgccatcattgacacttggatgtggttcttac
ggacgcaactcagttggggataacgttagtgccattaacctcttgaatatcaaaaaagtc
ggaagacggagaaataatatgcagtggtttaaagttccttcaaaaatttacttcgaacgc
aattctatccaataccttcaaacatgtgaagatattgaacgcgttctgattgttacagac
aaatctatcgaaaaactcggtttcgttcaacgtgttatcgatcaattgaacgcacgtagc
aaccgtgtaactatccaagtcttctcagatgttgaaccagatccagacatcacaactgta
gaacgtggtgctgaggtgatgaaagcatttgaaccagacacaatcattgctcttggtggt
ggttcaccaatggatgcagccaaagtaatgtggctcttctacgaacaaccagaaatcgac
ttccgtgacttggttcaaaaattcatggatatccgtaaacgcgccttccgcttcccatca
cttggtaagaaagcgaagtacatcggtatcccaacaacttcaggtactggttcagaagta
acaccatttgccgttatctctgataagaaaaacaaccgcaaatacccattggctgactac
tcattgacaccgactattgccattgttgaccctgctttggttgaatcagttccagacttt
atcgctgctgatacaggtatggatgtcttgacacacgcgactgaagcctacacttcaaac
tttgctaacgactatacagacggtattgcgcttcaaacaatcaaacttgtctttgaatgg
ttggaaaaatctgttaagacagctgacccagaagctcgtgagaaaatgcacaatgcgtct
acaatggctggtatggccttcgctaatgccttccttggaatgagccactcaatggcccat
aagattggtggtgttcatcacactgttcacggacgtacaaatgctatcttgcttccgtac
gttatccgttacaacggaactcgtccagctaagactactacatggcctaaatacaactac
tggaaagctgatgagaaattccaagacatcgcgaaaatgcttggcttgcctcactcaact
ccagaagaagcagttgaggcatacgctaaagctgtttacgaacttggtgttgcagtaggt
atcaagatgaacttccaggatcaaggaattgatgaaaaagcttggaaagacagcttgcat
gaaattgctttgcttgcttatgaagaccaatgttctcctgctaacccacgcttgccaatg
gtagctgacatggaagaaattatggcagatgcatattatggctacaaagaaagaccagga
cgccgtaaataa

DBGET integrated database retrieval system