KEGG   Streptococcus pseudopneumoniae: SPPN_10495Help
Entry
SPPN_10495        CDS       T01590                                 

Definition
threonine dehydrogenase-like Zn-dependent dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
std  Streptococcus pseudopneumoniae
Pathway
Glycolysis / Gluconeogenesis
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:std00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SPPN_10495
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPPN_10495
  Lipid metabolism
   00071 Fatty acid degradation
    SPPN_10495
  Amino acid metabolism
   00350 Tyrosine metabolism
    SPPN_10495
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SPPN_10495
   00626 Naphthalene degradation
    SPPN_10495
Enzymes [BR:std01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SPPN_10495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1985621..1986319)
Genome map
AA seq 232 aa AA seqDB search
MIDGMQAEYLRVPHADNTLYHTPEDLSDESLVMLSDILPTGYEIGVLKGEVEPGCSVAII
GSGPVGLAALLTAQLIMVDLDDNRLETALSFGATHKVNSSDPEKAIKEIYDLTDGRGVDV
AIEAVGIPVTFDFCQKIIGVDGTVANCGVHGKPVEFDLDKLWIRNINVTTGLVSTNTTPQ
LLKALESHKIEPEKLVTHYFKLSEIEKAYEVFGKAADHHAIKVIIENDISEA
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
ttgattgatggtatgcaggctgaatatctacgtgtccctcatgcagataacactctttac
catactccagaagacttgtcagatgaatccttggttatgctatcagacattctgcctact
ggatatgaaattggtgtcttaaaaggggaagtggaacctggttgtagcgtagctattatt
ggttcaggaccagttggattggctgcacttttgacagctcaattgattatggtagaccta
gatgataaccgcttggaaactgccctatcattcggtgcgactcataaggttaattcttca
gatcctgaaaaagccattaaagaaatttatgatttgacagatggtcgtggtgtggatgtc
gctatcgaagctgttggtattcctgtaacatttgatttctgtcaaaagattatcggtgta
gacggaacagttgccaactgtggtgtacatggtaaaccagttgaattcgatttggacaaa
ctttggattcgcaacatcaatgtaacaactggtttggtatctacaaatacaactccacaa
ttgttgaaagcacttgaaagtcataagattgaaccagaaaaattggtaactcactatttc
aaactcagtgaaattgaaaaagcctacgaagtcttcggtaaggcagcagaccaccatgcc
attaaggtcatcatcgaaaacgatatttctgaagcatag

DBGET integrated database retrieval system