KEGG   Streptococcus pseudopneumoniae: SPPN_10615Help
Entry
SPPN_10615        CDS       T01590                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
std  Streptococcus pseudopneumoniae
Pathway
std00040  Pentose and glucuronate interconversions
std00052  Galactose metabolism
std00500  Starch and sucrose metabolism
std00520  Amino sugar and nucleotide sugar metabolism
std01100  Metabolic pathways
std01130  Biosynthesis of antibiotics
Module
std_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:std00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SPPN_10615
   00052 Galactose metabolism
    SPPN_10615
   00500 Starch and sucrose metabolism
    SPPN_10615
   00520 Amino sugar and nucleotide sugar metabolism
    SPPN_10615
Enzymes [BR:std01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SPPN_10615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AEL11527
UniProt: G0I8D2
Position
2009687..2010586
Genome map
AA seq 299 aa AA seqDB search
MALKVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEDILVVTGK
SKRSIEDHFDSNFELEYNLKEKGKTDLLKLVDEATGMRLHFIRQTHPRGLGDAVLQAKAF
VGNEPFVVMLGDDLMDITDENAVPLTKQLMKDYERTHASTIAVMPVPHEDVSSYGVIAPQ
GEGINGLYSVETFVEKPATEDAPSDFAIIGRYLLTPEIFDILEKQAPGAGNEIQLTDAID
TLNKTQRVFAREFTGARYDVGDKFGFMKTSIDYALKHPQVKDDLKDYLIQLGKELAEKE
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggcactgaaagttagaaaagcagtcattcctgccgctggactaggaactcgattttta
ccagcaaccaaggcccttgccaaagaaatgttgccaattgtagacaaaccaactatccag
tttatcgtggaagaggctctcaaatcaggtattgaagatattctggttgtcactggtaag
tcaaaacgttctattgaggaccactttgattcaaattttgagcttgagtacaacctcaaa
gaaaaaggtaaaacagatctgttaaaattagtagatgaagcaactggcatgcgccttcat
ttcatccgccaaactcaccctcgtggtcttggagatgctgtcctacaagccaaagctttt
gtggggaatgagcccttcgttgttatgctgggcgatgaccttatggacatcacagatgag
aatgccgttcctttgacaaaacaactgatgaaggattacgagcggacacacgcatcaacc
attgctgtcatgcccgtaccacacgaagacgtttcatcatatggagtcattgctcctcaa
ggtgaaggaatcaacggactctatagcgttgaaactttcgttgaaaaaccagcgaccgaa
gatgcaccaagtgattttgcaatcatcggtcgctatctactcacacctgagatttttgat
atcctcgaaaagcaagctcctggtgctggaaatgaaatccaacttactgatgctattgat
acgctcaataaaacacagcgtgtttttgcccgtgaatttacaggagctcgttacgacgtt
ggggataagtttggatttatgaaaacatctattgactacgccctcaaacatccacaagtc
aaagatgacttaaaagattacctcatccaactgggaaaagaattggctgagaaggaataa

DBGET integrated database retrieval system