KEGG   Streptococcus pseudopneumoniae: SPPN_11135Help
Entry
SPPN_11135        CDS       T01590                                 

Definition
alpha-glycerophosphate oxidase
Orthology
K00105  
alpha-glycerophosphate oxidase [EC:1.1.3.21]
Organism
std  Streptococcus pseudopneumoniae
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:std00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SPPN_11135
Enzymes [BR:std01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.21  glycerol-3-phosphate oxidase
     SPPN_11135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2133980..2135806)
Genome map
AA seq 608 aa AA seqDB search
MEFSKKTREWSIKKMQERTLDLLIIGGGITGAGVALQAAASGLETGLIEMQDFAEGTSSR
STKLVHGGLRYLKQFDVEVVSDTVSERAVVQQIAPHIPKPDPMLLPVYDEDGATFSLFRL
KVAMDLYDLLAGVNNTPAANKVLSKNQVLERQPNLKKEGLVGGGVYLDFRNNDARLVIEN
IKRANQDGALIANHVKAEGFLFDESGKITGVVARDLLTDQVFEIKARLVINTTGPWSDKV
RNLSNKGTQFSQMRPTKGVHLVVDSSKIKVSQPVYFDTGLGDGRMVFVLPRENKTYFGTT
DTDYTGDLEHPKVTQEDVDYLLGIVNNRFPEANITVADIESSWAGLRPLIAGNSASDYNG
GNNGTISDESFDNLIATVESYLSKEKTREDVESAVSKLESSTSEKHLDPSAVSRGSSLDR
DDNGLLTLAGGKITDYRKMAEGAMERVVDILKAEFDRSFKLINSKTYPVSGGELNPANVD
SEIEAFAQLGVSRGLDSKEAHYLANLYGSNAPKVFALAHSLEQAPGLSLADTLSLHYAMR
NELTLSPVDFLLRRTNHMLFMRDSLDSIVEPVLDEMGRFYDWTEEEKATYRADVKAALAN
NDLAELKN
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atggaattttcaaagaaaacacgtgaatggtcaattaaaaaaatgcaggaacgcaccctg
gatctcttgattatcggtggaggaatcacaggggctggtgtagccttgcaggcggcagct
agcggtcttgagaccggtttgattgaaatgcaggacttcgcagaaggaacatccagccgt
tcaacaaaattggttcacggcggtcttcgctacctcaaacaattcgacgtagaagtagta
tcagatacggtttcagaacgtgcagtagtacaacaaattgctccacacattccaaaacca
gacccaatgctcttaccagtttacgatgaagatggagcgacctttagcctcttccgtctt
aaagtagccatggacttgtacgatctcttggcaggtgtcaacaatacaccagctgctaac
aaggttttgagtaagaatcaagtcttggaacgccagccaaacttgaagaaagaaggcttg
gtaggaggtggagtgtatcttgacttccgtaacaacgatgcgcgtctcgtgattgaaaac
atcaaacgtgccaaccaagacggtgccctcattgccaaccacgtgaaggcagaaggcttc
ctctttgacgaaagtggcaagattacaggtgttgtagctcgtgatctcttgacagaccaa
gtatttgaaatcaaggcccgtctggttattaatacaacaggtccttggagtgataaagta
cgtaatttgtctaataagggaacgcaattctcacaaatgcgcccaactaagggagttcac
ttggtagtggattcaagcaaaatcaaggtttcacagccagtttactttgacacaggtttg
ggtgacggtcgtatggtctttgttctcccacgtgaaaacaagacctactttggtacaact
gatacagactatacaggtgatttggagcatccaaaagtaactcaagaagatgtagattac
ctacttggtattgtcaacaaccgcttcccagaagcgaatattacagttgctgacattgaa
agtagctgggcaggtcttcgtccattgattgcagggaacagtgcctctgactataatggt
ggaaataacggtaccatcagtgatgaaagctttgacaacttgattgcgactgttgaatct
tatctctccaaagaaaaaacacgtgaagatgttgagtctgctgtcagcaagcttgaaagt
agcacatctgagaaacatttggatccatctgcagtttctcgtgggtctagcttggaccgt
gatgataatggtctcttgactcttgctggtggtaaaatcacagactaccgtaagatggct
gaaggagctatggagcgcgtggttgatatcctcaaagcagaatttgaccgtagctttaaa
ctcatcaactcgaagacttaccctgtttcaggtggagaattgaatccagcaaatgtggac
tcagaaatcgaagcctttgcgcaacttggagtttcacgtggcttggatagcaaggaagct
cactatctagcaaatctttacggttcaaatgcaccgaaagtctttgcccttgctcacagc
ttggaacaagcgccaggtcttagcctggcagacaccttgtcccttcactatgcaatgcgc
aacgagttgactcttagcccggttgacttccttcttcgtcgtaccaaccatatgctcttt
atgcgtgatagtttggacagcatcgttgagccagttttggatgaaatgggacgattctat
gactggacagaagaagaaaaagcaacttaccgtgctgatgtaaaagcagctcttgctaat
aatgatttagcagaattaaaaaattaa

DBGET integrated database retrieval system