KEGG   Streptococcus thermophilus LMD-9: STER_0770Help
Entry
STER_0770         CDS       T00414                                 

Definition
glucose kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ste  Streptococcus thermophilus LMD-9
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ste00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    STER_0770
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STER_0770
   00052 Galactose metabolism
    STER_0770
   00500 Starch and sucrose metabolism
    STER_0770
   00520 Amino sugar and nucleotide sugar metabolism
    STER_0770
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    STER_0770
   00524 Butirosin and neomycin biosynthesis
    STER_0770
Enzymes [BR:ste01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     STER_0770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
701332..702300
Genome map
AA seq 322 aa AA seqDB search
MSKKLLGIDLGGTTVKFGILTADGEVQEKWAIETNTFENGSHIVPDIVESLKHRLELYGL
TAEDFIGIGMGSPGAVDRENKTVTGAFNLNWAETQEVGSVIEKELGIPFAIDNDANVAAL
GERWVGAGANNRNVVFITLGTGVGGGVIADGNLIHGVAGAGGEIGHIIVEPDTGFECTCG
NKGCLETVASATGIVRVAHHLAGKCEGNSSIKAAVDNGEFVTSKDIIVAATEGDKFADSI
VDKVSKYLGLATANISNILNPDSVVIGGGVSAAGEFLRSRVEGYFTRYAFPQVRRTTKVK
LAELGNDAGIIGAASLAYSIDK
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagaaactcttaggtattgaccttggtggaacaactgttaagtttggtattttg
actgcagatggtgaagttcaagaaaaatgggctattgaaacaaatacgtttgaaaatggt
agccacattgttcctgacattgtagaatctttgaaacaccgtttggaattgtatggactt
actgctgaagattttattggaattggtatgggatctccaggtgcagttgaccgagaaaat
aaaacagtaacgggtgcctttaacttgaactgggcagaaactcaagaagttggctctgtt
attgaaaaagaacttggtattccattcgctattgataatgatgctaatgtggctgcactg
ggtgaacgttgggttggtgctggtgctaacaatcggaatgttgtctttataacattgggt
acaggtgttggtggcggtgttatcgctgatggtaacttaattcatggtgttgccggtgct
ggtggggaaattggtcacattattgttgaacctgacacaggatttgagtgtacttgcgga
aacaaggggtgtctggaaactgtagcttcagcaacaggtattgtacgtgtagcacatcat
ttggcaggaaaatgcgaaggaaactcttctattaaagctgctgtagacaatggtgagttt
gtgacaagtaaagatattatcgtagctgctactgaaggtgataagtttgctgacagcatt
gttgataaagtctctaaatacctcggacttgcaacagcaaacatctcaaacattcttaac
ccagattctgtcgttatcggtggtggtgtttctgccgcaggagaattcttgcgtagtcgt
gttgaaggatactttacacgttatgcattcccacaagttcgccgtacaacaaaagtgaaa
ttagcggagcttggaaatgatgcaggaatcattggagctgctagtcttgcttatagtatt
gacaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system