KEGG   Streptococcus thermophilus LMD-9: STER_0938Help
Entry
STER_0938         CDS       T00414                                 

Definition
arginase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
ste  Streptococcus thermophilus LMD-9
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ste00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    STER_0938
Enzymes [BR:ste01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     STER_0938
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
868243..868986
Genome map
AA seq 247 aa AA seqDB search
MKILSIIYDGGSRIPGARFAPTKYYQEAMLYDRKDSDIITINLGNQDLFSIDLESLSRTI
AESKVQIALGGDHSVTYLLAKATVREGAYLIVLDAHLDYFKDFESVVKNWNFLSFLTDIF
EKIIIIGERNFEFPSSFDNKIIILSMEEYWLNKSRVLKKLDSYIDESKDIYLSIDIDVLD
PSVFDSVSYPIIGGFQMNDFLGIISKILCSDKVYFCDIVEYNPMVGSDNAHIFYQMIQFV
KSKLRRI
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatattatctattatttatgatggtggaagtagaattccaggagcgagatttgct
cccacaaaatattatcaagaagcgatgttatatgataggaaagattctgatataattaca
attaatttaggtaatcaagatttattttctattgatttagaaagtctaagtcgaactatt
gctgaatctaaagttcagattgctttaggaggagatcattcagttacttatctattagca
aaggccactgttcgagagggagcatatttaattgttttagatgctcatttagattacttc
aaagactttgaaagtgttgtaaaaaattggaattttttaagttttttaaccgatattttt
gaaaaaataattatcattggggaaaggaattttgagtttcctagttcatttgataataaa
ataatcatcctctcaatggaggagtattggttaaataagagtagagttttgaaaaagtta
gatagttatattgatgagtcaaaagatatttacttatcaatagacattgatgttttggat
ccatctgtttttgattcagtatcatatcctattattggaggatttcaaatgaacgatttt
cttggaataatttccaaaattttatgttctgataaggtatatttttgtgatatagttgag
tacaatccgatggttggaagtgataatgctcacattttttaccaaatgattcaatttgtt
aaatcaaaattaaggaggatatag

DBGET integrated database retrieval system