KEGG   Streptococcus thermophilus LMD-9: STER_0938Help
Entry
STER_0938         CDS       T00414                                 

Definition
arginase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
ste  Streptococcus thermophilus LMD-9
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ste00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
868243..868986
Genome map
AA seq 247 aa AA seqDB search
MKILSIIYDGGSRIPGARFAPTKYYQEAMLYDRKDSDIITINLGNQDLFSIDLESLSRTI
AESKVQIALGGDHSVTYLLAKATVREGAYLIVLDAHLDYFKDFESVVKNWNFLSFLTDIF
EKIIIIGERNFEFPSSFDNKIIILSMEEYWLNKSRVLKKLDSYIDESKDIYLSIDIDVLD
PSVFDSVSYPIIGGFQMNDFLGIISKILCSDKVYFCDIVEYNPMVGSDNAHIFYQMIQFV
KSKLRRI
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatattatctattatttatgatggtggaagtagaattccaggagcgagatttgct
cccacaaaatattatcaagaagcgatgttatatgataggaaagattctgatataattaca
attaatttaggtaatcaagatttattttctattgatttagaaagtctaagtcgaactatt
gctgaatctaaagttcagattgctttaggaggagatcattcagttacttatctattagca
aaggccactgttcgagagggagcatatttaattgttttagatgctcatttagattacttc
aaagactttgaaagtgttgtaaaaaattggaattttttaagttttttaaccgatattttt
gaaaaaataattatcattggggaaaggaattttgagtttcctagttcatttgataataaa
ataatcatcctctcaatggaggagtattggttaaataagagtagagttttgaaaaagtta
gatagttatattgatgagtcaaaagatatttacttatcaatagacattgatgttttggat
ccatctgtttttgattcagtatcatatcctattattggaggatttcaaatgaacgatttt
cttggaataatttccaaaattttatgttctgataaggtatatttttgtgatatagttgag
tacaatccgatggttggaagtgataatgctcacattttttaccaaatgattcaatttgtt
aaatcaaaattaaggaggatatag

DBGET integrated database retrieval system