KEGG   Streptococcus thermophilus LMD-9: STER_0949Help
Entry
STER_0949         CDS       T00414                                 

Definition
threonine dehydrogenase or related Zn-dependent dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
ste  Streptococcus thermophilus LMD-9
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ste00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    STER_0949
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STER_0949
  Lipid metabolism
   00071 Fatty acid degradation
    STER_0949
  Amino acid metabolism
   00350 Tyrosine metabolism
    STER_0949
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    STER_0949
   00626 Naphthalene degradation
    STER_0949
Enzymes [BR:ste01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     STER_0949
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
879372..880409
Genome map
AA seq 345 aa AA seqDB search
MKSAVYTKAGQVGLAEIDRPQIVAADDAIIKIVRTCVCGSDLWSYRNPEMEEGHRNSGHE
AIGIVEEVGEQVTTVKPGDFVIAPFTHGCGQCDACRAGFDGSCDNHSGNNWSEGVQAEYI
RFHFANWALVKILGQPSDYSEGMLKSLLTLADVMPTGYHAARVANVQKGDKVVVIGDGAV
GQCAVIASKMRGASQIVLMSRHEDRQKMALESGATAVVAERGEKGIDKVREILGGGADAA
LECVGTEAAVEQALGVLHNGGRMGFVGVPHYNNRSLGSTFAQNILVAGGVASVTTYDKQV
LLKAVLDGDINPGRVFTTSYKLEDINQAYKDMDERKSIKSMIVLD
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcagcagtttataccaaagctggacaagtggggctggcagaaattgatcgcccg
caaatcgtggcagcagatgatgccattatcaagatagtacgtacttgcgtttgtggatct
gacctttggagttaccgtaatccggaaatggaagagggacatagaaatagtggtcatgag
gctatcggaattgtcgaagaagttggtgagcaagttactacggtaaaaccaggagacttt
gtcattgcacctttcacacatgggtgtggtcagtgtgatgcttgtcgagctggttttgac
ggctcttgtgataaccactcaggtaataactggtctgagggcgtgcaggctgagtatatc
cgtttccactttgccaactgggcccttgtcaaaattcttgggcaaccctcagattatagc
gaaggcatgctcaagtcacttttgacacttgctgatgttatgccgacgggttaccatgct
gcgcgtgtggctaatgtacaaaagggtgataaggttgtcgttatcggagatggggctgtt
ggtcaatgtgctgtcattgcatctaagatgcgtggagcttctcaaattgtccttatgagc
cgtcacgaagatcgtcaaaagatggctttggagtcaggtgcgactgcggttgtagctgag
cgtggcgaaaaaggcattgacaaagtccgtgaaatcctcgggggaggagcagatgcagct
ctcgagtgtgtcggtactgaagcagcagtagaacaagctcttggtgtcctccataacggt
ggtcgtatgggatttgtcggtgtgcctcattataataaccgttcccttggttcgaccttt
gcccaaaatattttagtggcgggaggggtagcctctgtcacaacctatgataaacaagtt
ttgttaaaagctgttcttgatggcgacatcaatccaggccgagtctttacgacaagttat
aaattggaagatattaatcaggcttataaagatatggatgaacgcaagtctattaaatct
atgattgttttagattag

DBGET integrated database retrieval system