KEGG   Streptococcus thermophilus LMD-9: STER_0949Help
Entry
STER_0949         CDS       T00414                                 

Definition
threonine dehydrogenase or related Zn-dependent dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
ste  Streptococcus thermophilus LMD-9
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ste00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    STER_0949
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STER_0949
  Lipid metabolism
   00071 Fatty acid degradation
    STER_0949
  Amino acid metabolism
   00350 Tyrosine metabolism
    STER_0949
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    STER_0949
   00626 Naphthalene degradation
    STER_0949
Enzymes [BR:ste01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     STER_0949
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
879372..880409
Genome map
AA seq 345 aa AA seqDB search
MKSAVYTKAGQVGLAEIDRPQIVAADDAIIKIVRTCVCGSDLWSYRNPEMEEGHRNSGHE
AIGIVEEVGEQVTTVKPGDFVIAPFTHGCGQCDACRAGFDGSCDNHSGNNWSEGVQAEYI
RFHFANWALVKILGQPSDYSEGMLKSLLTLADVMPTGYHAARVANVQKGDKVVVIGDGAV
GQCAVIASKMRGASQIVLMSRHEDRQKMALESGATAVVAERGEKGIDKVREILGGGADAA
LECVGTEAAVEQALGVLHNGGRMGFVGVPHYNNRSLGSTFAQNILVAGGVASVTTYDKQV
LLKAVLDGDINPGRVFTTSYKLEDINQAYKDMDERKSIKSMIVLD
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcagcagtttataccaaagctggacaagtggggctggcagaaattgatcgcccg
caaatcgtggcagcagatgatgccattatcaagatagtacgtacttgcgtttgtggatct
gacctttggagttaccgtaatccggaaatggaagagggacatagaaatagtggtcatgag
gctatcggaattgtcgaagaagttggtgagcaagttactacggtaaaaccaggagacttt
gtcattgcacctttcacacatgggtgtggtcagtgtgatgcttgtcgagctggttttgac
ggctcttgtgataaccactcaggtaataactggtctgagggcgtgcaggctgagtatatc
cgtttccactttgccaactgggcccttgtcaaaattcttgggcaaccctcagattatagc
gaaggcatgctcaagtcacttttgacacttgctgatgttatgccgacgggttaccatgct
gcgcgtgtggctaatgtacaaaagggtgataaggttgtcgttatcggagatggggctgtt
ggtcaatgtgctgtcattgcatctaagatgcgtggagcttctcaaattgtccttatgagc
cgtcacgaagatcgtcaaaagatggctttggagtcaggtgcgactgcggttgtagctgag
cgtggcgaaaaaggcattgacaaagtccgtgaaatcctcgggggaggagcagatgcagct
ctcgagtgtgtcggtactgaagcagcagtagaacaagctcttggtgtcctccataacggt
ggtcgtatgggatttgtcggtgtgcctcattataataaccgttcccttggttcgaccttt
gcccaaaatattttagtggcgggaggggtagcctctgtcacaacctatgataaacaagtt
ttgttaaaagctgttcttgatggcgacatcaatccaggccgagtctttacgacaagttat
aaattggaagatattaatcaggcttataaagatatggatgaacgcaagtctattaaatct
atgattgttttagattag

DBGET integrated database retrieval system