KEGG   Streptococcus thermophilus LMD-9: STER_1017Help
Entry
STER_1017         CDS       T00414                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ste  Streptococcus thermophilus LMD-9
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ste00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    STER_1017
Enzymes [BR:ste01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     STER_1017
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(940910..942391)
Genome map
AA seq 493 aa AA seqDB search
MHITSLPGDYGIGSFGQAAYDFVDFLKETKQTYWQILPLTTTSYGDSPYQSFSAIAGNTH
FIDLDFLIRDGFLTEADVEGSDFGSDPEFIDYAKVYEARRPLLEKAVKAILADENEAKKF
ETFKAENANWLADYADFMAIKEYFGNKALQDWDDKKAIKRDEATLEKLRKELTGVITYHQ
VVQYLFFSQWAELKSYANKNGIQIIGDMPIYVSADSVEVWTQPHLFKLDAECKPRYIAGV
PPDNFSPTGQLWGNPIYDWDKHKAENYAWWVFRIQESFKLFDCLRIDHFKGFSDFWEIPA
GDETAENGKWVPGPGYDLFKVVKEELGDLKIIAEDLGNIDDKTRKLLADCGYPGMKILHF
GFYDTTGNSIYVPHAYTQHSVAYTGTHDNEVTNGWYNNLTQEQRDYTDAYINRRQGEPIT
RALLRTLFATVSNTAIATMQDILDKNENSRKNIPNTVGGNWRWRMLPGEITVDKKEFLTD
ITERYNRGNRGNK
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgcacatcacatcacttccaggtgactacggaatcggatcttttggtcaagcagcctac
gactttgttgatttcttgaaagaaacaaagcaaacatactggcaaattttgccattgact
actacaagttatggagattcaccttaccaatcattctcagcaatagcgggaaatactcac
tttatcgatttggatttccttattcgtgacggattcctgactgaagcagatgttgaaggt
tctgattttggttcagatccagagtttatcgactacgctaaagtttacgaagcacgacgc
ccacttcttgaaaaagcagtcaaagcaatcttggcagatgaaaacgaagctaagaagttt
gaaactttcaaagctgaaaatgctaactggttggcagattatgctgacttcatggctatc
aaagaatactttggtaacaaagcccttcaagattgggatgataaaaaagcgattaaacgt
gatgaagcaactcttgaaaagcttcgcaaagaacttaccggtgttatcacataccatcaa
gttgtgcaatacctcttctttagccaatgggcagagttgaaatcctatgctaataagaac
ggtattcaaattattggtgatatgccaatctacgtttcagctgatagtgtggaagtctgg
actcaaccacacctcttcaaattagatgctgaatgtaagccacgttacattgccggagtt
ccaccagataacttctcaccaacaggacaactttgggggaatccaatttatgattgggat
aaacacaaagcagaaaactatgcttggtgggtcttccgtattcaagaatcatttaaactt
tttgattgcttgcgtatcgaccacttcaaaggtttctctgatttctgggaaattcctgct
ggagatgaaactgctgaaaatggtaaatgggttccaggacctggttatgacctcttcaaa
gtggttaaagaagagttgggtgatcttaagattattgccgaagaccttggtaatattgat
gataagacacgtaaacttcttgcagactgtggttacccaggaatgaagattcttcacttt
ggtttctatgataccactggtaacagcatttatgttccacacgcatacacacaacactca
gtggcttacactggtacacatgataatgaagttactaatggttggtataataacttgaca
caagagcaacgtgattacactgatgcttatatcaaccgtcgtcaaggtgaaccaatcaca
cgtgcccttcttcgcacactcttcgcaacagtaagtaacacagctattgcgactatgcaa
gatattcttgataaaaatgaaaatagccgtaaaaacatccctaacacagttggaggaaac
tggagatggcgtatgcttccaggtgaaatcaccgttgataaaaaagaatttttgactgat
attacagaaagatataatcgaggaaatcgaggaaataaataa

DBGET integrated database retrieval system