KEGG   Streptococcus thermophilus LMD-9: STER_1123Help
Entry
STER_1123         CDS       T00414                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
ste  Streptococcus thermophilus LMD-9
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ste00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    STER_1123
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    STER_1123
Enzymes [BR:ste01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     STER_1123
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1036555..1037826)
Genome map
AA seq 423 aa AA seqDB search
MDKIIVKGGNTRLSGEVVIEGAKNSVLPLLAATILASEGQTTLTNVPILSDVYTMNNVVR
GLDIAVDFDEENNTVVVDASGEILDQAPYEYVSKMRASIVVLGPILARNGHAKVSMPGGC
TIGSRPIDLHLKGLEAMGAKITQVGGDITATAEKLKGATIYMDFPSVGATQNLMMAATLA
DGVTTIENAAREPEIVDLAILLNEMGANVKGAGTEKLVIKGVKSLHGTQHAVIQDRIEAG
TFMVAAAMTSGNVLIKDAIWEHNRPLISKLLEMGVDVKEEDRGIRVKSDVSKLKPVAVKT
LPHPGFPTDMQAQFTALMAVVKGKSSISETVFENRFQHLEEMRRMGLHSEILRDTAMIHG
GLPLQGARVMSTDLRASAALILTGMVAEGTTTVGKLTHLDRGYYKFHEKLAKLGAQISRV
SEA
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggataaaattattgtgaagggtggcaacactcgattaagtggtgaggttgtcattgaa
ggtgctaaaaactctgtccttcctttgttggcggcgactatcttggcctcagaaggtcaa
acaaccttaactaatgttccaatcttgtcagatgtttatacgatgaataatgttgtccgt
ggtttagatattgctgtagactttgacgaggaaaacaataccgttgtagttgatgctagt
ggagaaattctcgatcaagcaccatatgagtatgtgagtaagatgcgtgcgtcaatcgta
gttcttgggcctattcttgctcgtaatggtcatgctaaggtctcaatgcctggcggttgt
acgattggtagtcgtcctattgacctccaccttaaaggtttggaagctatgggtgctaaa
attacccaagttggtggtgatatcaccgcgacagcagaaaaacttaaaggtgcaactatt
tatatggacttcccatcagttggtgctactcagaaccttatgatggcagccactttagct
gatggagtcactaccattgaaaatgctgcgcgtgaaccggaaatcgttgacttggctatt
cttcttaacgagatgggagcaaatgtcaaaggtgctggaactgaaaaactcgtgattaaa
ggtgttaaatctcttcatggtacgcaacatgcggttattcaggaccgtattgaagcaggt
acttttatggtagcagcagccatgacttctggcaatgttcttattaaagatgctatctgg
gaacataaccgtcctttgatttctaaattattggaaatgggtgtcgacgttaaggaagag
gacagaggcattcgtgttaaatctgatgtttcgaaattgaaacctgtagctgttaaaacc
ctacctcacccaggttttccaactgacatgcaggctcaatttacggctcttatggcagtt
gtgaaaggtaaatcaagcataagtgaaacagtcttcgagaatcgtttccaacatttagag
gaaatgcgtcgtatggggcttcattctgaaatccttcgtgatactgcaatgattcacggt
ggtttgccacttcaaggagcgcgagttatgtctactgaccttcgagcttctgcagccctt
atcctcacagggatggttgctgaaggaacaacaactgttgggaaattgacacacttggat
cgtggttactataaattccatgagaaactagctaaactaggagcccaaatttcacgtgta
agtgaggcatag

DBGET integrated database retrieval system