KEGG   Streptococcus thermophilus LMD-9: STER_1164Help
Entry
STER_1164         CDS       T00414                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ste  Streptococcus thermophilus LMD-9
Pathway
ste00010  Glycolysis / Gluconeogenesis
ste00030  Pentose phosphate pathway
ste00051  Fructose and mannose metabolism
ste00052  Galactose metabolism
ste00680  Methane metabolism
ste01100  Metabolic pathways
ste01110  Biosynthesis of secondary metabolites
ste01120  Microbial metabolism in diverse environments
ste01130  Biosynthesis of antibiotics
ste01200  Carbon metabolism
ste01230  Biosynthesis of amino acids
ste03018  RNA degradation
Module
ste_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ste00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STER_1164
   00030 Pentose phosphate pathway
    STER_1164
   00051 Fructose and mannose metabolism
    STER_1164
   00052 Galactose metabolism
    STER_1164
  Energy metabolism
   00680 Methane metabolism
    STER_1164
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    STER_1164
Enzymes [BR:ste01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     STER_1164
Protein phosphatases and associated proteins [BR:ste01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     STER_1164
Messenger RNA biogenesis [BR:ste03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     STER_1164
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ABJ66355
JGI: STER1164
UniProt: Q03KB7
Position
complement(1073225..1074244)
Genome map
AA seq 339 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAVRAVVLKAISEGIEVFGINRGYAGMVEGDIFKLDAKRVENI
LSRGGTFLQSARYPEFAQLEGQLKGIEQLKKYGIEGVVVIGGDGSYHGAMRLTEHGFPAV
GLPGTIDNDIVGTDYTIGFDTAVATATEALDKIQDTAFSHGRTFVVEVMGRNAGDIALWA
GIASGADQIIVPEEEYDINEVVRKVKEGYESGEKSHHIIVLAEGVMGAEEFAAKMKEAGD
TSDLRATNLGHVIRGGSPTARDRVLASWMGAHAVDLLKEGIGGVAVGIHNEQLVESPILG
TAEEGALFSLTEDGKIIVNNPHKARLDFAELNRSLANLK
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgctgttttgaccagtggtggagatgcccctggtatgaacgctgccgtt
cgtgcagttgttctcaaagcaatttctgaaggaattgaagtgttcggcattaaccgtgga
tacgccggtatggttgaaggagatatcttcaaacttgatgccaaacgcgtagaaaacatc
cttagccgtggtggcactttccttcagtctgctcgctatcccgagtttgcccaacttgaa
ggtcaacttaaaggtattgagcaacttaaaaaatatggaatcgaaggtgtagttgttatt
ggtggagatggttcttaccatggtgctatgcgtttgactgaacatggtttcccagcagtt
ggtctcccaggaactatcgataacgatatcgttggtacagactatacaattggatttgat
acagccgttgcaactgcaacagaagctttggataaaatccaagatacagctttcagtcat
ggacgtacttttgtcgttgaggtaatgggacgtaacgctggtgatatcgctctttgggct
ggtattgcttcaggtgctgaccaaattattgtgccagaagaagaatatgacatcaacgaa
gtggttcgtaaagttaaagaaggttatgaatctggcgaaaaatctcaccacattattgtg
cttgctgagggcgttatgggtgctgaagagtttgcagctaaaatgaaagaagctggagat
acatcagaccttcgtgctacaaatcttggacacgtaattcgtggtggttcaccaactgca
cgtgaccgtgttcttgcttcatggatgggtgcacatgccgttgatcttcttaaagaagga
attggtggtgttgctgtgggtatccataatgaacagcttgttgaaagtccaatccttggt
acagcagaagaaggtgctttgttcagtcttactgaagacggtaaaattatcgtaaacaat
ccacacaaagctcgccttgattttgcagagcttaaccgttctttagctaacttgaaataa

DBGET integrated database retrieval system