KEGG   Streptococcus thermophilus LMD-9: STER_1172Help
Entry
STER_1172         CDS       T00414                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ste  Streptococcus thermophilus LMD-9
Pathway
ste00010  Glycolysis / Gluconeogenesis
ste00260  Glycine, serine and threonine metabolism
ste00680  Methane metabolism
ste01100  Metabolic pathways
ste01110  Biosynthesis of secondary metabolites
ste01120  Microbial metabolism in diverse environments
ste01130  Biosynthesis of antibiotics
ste01200  Carbon metabolism
ste01230  Biosynthesis of amino acids
Module
ste_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ste_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ste00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STER_1172
  Energy metabolism
   00680 Methane metabolism
    STER_1172
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    STER_1172
Enzymes [BR:ste01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     STER_1172
Membrane trafficking [BR:ste04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    STER_1172
Exosome [BR:ste04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   STER_1172
  Exosomal proteins of melanoma cells
   STER_1172
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ABJ66363
JGI: STER1172
UniProt: Q03KA9
Position
complement(1083741..1084433)
Genome map
AA seq 230 aa AA seqDB search
MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIEFDKAYTSVLKR
AIKTTNLALEASDQLWVPVEKSWRLNERHYGGLTGKNKAEAAEQFGDEQVHIWRRSYDVL
PPKMDRDDEYSAHKDRRYASLDDSVIPDAENLKVTLERALPFWEDKIAPALKDGKNVFVG
AHGNSIRALVKHIKKLSDDEIMDVEIPNFPPLVFEFDEKLNVVSEYYLGK
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaattggttttcgctcgccacggtgagtctgaatggaacaaagctaatcttttc
acaggttgggctgacgtagatctttctgaaaaaggtactcaacaagctattgacgctggt
aaattgattaaagaagctggtattgaatttgacaaagcttacacttcagtattgaaacgt
gcgatcaaaacaactaaccttgcgcttgaagcctctgaccaactttgggttccagttgaa
aaatcatggcgcttgaacgaacgtcactacggtggtttgactggtaaaaataaagcagaa
gctgctgaacaatttggtgatgagcaagttcacatctggcgtcgttcatacgatgtattg
cctccaaaaatggaccgtgatgatgagtactcagcacacaaagaccgtcgttacgcttca
cttgacgattcagtaattccagatgctgaaaacttgaaagtaactttggaacgtgccctt
ccattctgggaagataaaattgctccagctcttaaagatggtaaaaacgtattcgtaggt
gcacatggtaactcaatccgtgcccttgtaaaacacatcaaaaaattgtcagatgacgaa
atcatggatgttgaaattccaaacttcccaccattggtatttgaatttgacgaaaaattg
aacgttgtttctgaatattacctcggaaaataa

DBGET integrated database retrieval system