KEGG   Streptococcus thermophilus LMD-9: STER_1201Help
Entry
STER_1201         CDS       T00414                                 

Definition
(GenBank) 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase
  KO
K01814  
phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase [EC:5.3.1.16]
Organism
ste  Streptococcus thermophilus LMD-9
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:ste00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    STER_1201
Enzymes [BR:ste01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.16  1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase
     STER_1201
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1108788..1109507)
Genome map
AA seq 239 aa AA seqDB search
MQILPAIDIKDGQAVRLFKGDFNQKTVVNPDIIEQAKTFKNAGIQFIHLVDLDGTLDGRA
TNRDLITEVKKISGLGIEVGGGIRTLEQIRDYLAVGIDRIIIGSMAVKDPDFVRAALEEF
GADRIVVGIDAKAGLVATEGWLETSNVDYITLAKEMEKMGVTLFIYTDVDRDGTLTGPNL
DHYKCLVSELTTAKVIASGGVAELADLNHLQEIGVAGTIVGKAYYNGNITLDQLKSFGG
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgcaaattctaccagcaattgatattaaggatggacaggcagttcgtctcttcaaagga
gatttcaaccaaaaaaccgtcgtcaatccagatattattgagcaagcaaagacttttaag
aatgcgggcatccaattcattcaccttgttgacttggatggtactcttgatggtcgtgcc
actaaccgtgacttgattacagaggtcaagaagatttctggacttggcatcgaagttggt
ggcggtatccgcaccttggagcagattcgtgactatttggcagttggcatcgaccgtatc
attatcggttcaatggccgtcaaagatcctgacttcgttagagcagctttggaggaattt
ggtgccgataggattgtcgtgggtatagatgccaaggcaggtcttgtcgctacagaaggt
tggttggaaaccagtaatgtggactacatcaccttggccaaggaaatggaaaaaatgggc
gtaaccctctttatttatacagacgttgatcgagatggcacactgacaggacccaatctt
gatcactacaaatgtttggtatctgaactcacaaccgctaaagtcatcgcttcaggtggg
gttgcagagctagccgacttaaatcacttacaagagattggtgtagcaggaaccattgtc
ggtaaggcctactataacggcaatatcactttagaccagctcaagtctttcggaggttaa

DBGET integrated database retrieval system