KEGG   Streptococcus thermophilus LMD-9: STER_1366Help
Entry
STER_1366         CDS       T00414                                 

Definition
beta-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
ste  Streptococcus thermophilus LMD-9
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ste00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:ste00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1270875..1273955)
Genome map
AA seq 1026 aa AA seqDB search
MNMTEKIQTYLNDPKIVSVNTVDAHSDHKYFESLEEFSEGEMKLRQSLNGKWKIHYAQNT
NQVLKDFYKTEFDETDLNFINVPGHLELQGFGSPQYVNTQYPWDGKEFLRPPQVPQESNA
VASYVKHFTLNDALKDKKVFISFQGVATSIFVWVNGNFVGYSEDSFTPSEFEISDYLVEG
DNKLAVAVYRYSTASWLEDQDFWRLYGIFRDVYLYAIPKVHVQDLFVKGDYDYQTKAGQL
DIDLKTVGDYEDKKIKYVLSDYEGIVTEGDASVNGDGELSVSLENLKIKPWSAESPKLYD
LILHVLDDDQVVEVVPVKVGFRRFEIKDKLMLLNGKRIVFKGVNRHEFNARTGRCITEED
MLWDIKVMKQHNINAVRTSHYPNQTRWYELCDEYGLYVIDEANLETHGTWQKLGLCEPSW
NIPASEPEWLPACLDRANNMFQRDKNHASVIIWSCGNESYAGKDIADMADYFRSVDNTRP
VHYEGVAWCREFDYITDIESRMYAKPADIEEYLTTGKLVDLSSVSDKHFASGNLTNKPQK
PYISCEYMHTMGNSGGGLQLYTDLEKYPEYQGGFIWDFIDQAIYKTLPNGSEFLSYGGDW
HDRPSDYEFCGNGIVFADRTLTPKLQTVKHLYSNIKIAVDEKSVTIKNDNLFEDLSAYTF
LARVYEDGRKVSESEYHFDVKPGEEATFPVNFVVEASNSEQIYEVACVLREATEWAPKGH
EIVRGQYVVEKISTETPVKAPLNVVEGDFNIGIQGQNFSILLSRAQNTLVSAKYNGVEFI
EKGPKLSFTRAYTDNDRGAGYPFEMAGWKVAGNYSKVTDTQIQIEDDSVKVTYVHELPGL
SDVEVKVTYQVDYKGRIFVTANYDGKAGLPNFPEFGLEFAIGSQFTNLSYYGYGAEESYR
DKLPGAYLGRYETSVEKTFAPYLMPQESGNHYGTREFTVSDDNHNGLKFTALNKAFEFSA
LRNSTEQIENARHQYELQESDATWIKVLAAQMGVGGDDTWGAPVHDEFLLSSADSYQLSF
MIEPLN
NT seq 3081 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgactgaaaaaattcaaacttatttaaacgatccaaagattgttagcgttaat
actgttgatgctcactcagatcataagtattttgaatctcttgaagaattttctgaaggg
gagatgaagttaagacaatctcttaatggaaaatggaaaattcactatgctcagaataca
aatcaggttttaaaagacttttataaaacagaatttgatgaaactgatttgaatttcatc
aatgtaccaggtcatttagagcttcaaggttttggttctccacaatatgtgaatacccaa
tatccttgggatggtaaagaattccttcgtccacctcaagttcctcaagaatcaaatgct
gttgcatcatacgttaaacattttaccttgaatgatgcattaaaagataaaaaagtattt
atctcattccaaggggttgctacttccatctttgtatgggtcaatggtaacttcgtagga
tacagtgaagattcatttacacctagtgaatttgaaattagtgattaccttgttgaaggt
gataacaagttggcggtagctgtttatcgttattctacagcaagctggttggaagaccaa
gacttctggagactttacggtatttttagagatgtttacttgtatgctattccaaaagtt
cacgttcaagatctctttgttaagggagattatgattaccaaacaaaagcaggtcaattg
gatattgatttgaagactgttggtgattatgaagacaagaagattaaatatgttctttca
gattatgaaggcatcgttacagaaggtgatgcatctgttaatggtgacggtgaactatct
gtaagtcttgaaaatcttaaaatcaaaccttggagtgctgaaagtcctaaactttacgat
ttgatccttcatgttttggatgatgaccaagttgttgaagtcgttccagttaaagttgga
tttagacgctttgaaattaaagataaacttatgcttttgaatggtaagagaattgtcttt
aaaggggttaacagacacgaatttaacgctagaacaggacgttgtatcactgaagaagat
atgctttgggatatcaaagtgatgaaacaacataacatcaatgctgttcgtacttcacac
tatcctaaccaaacacgttggtatgaattgtgtgatgaatatggactttatgttatcgat
gaagccaaccttgaaacacacggtacatggcaaaaacttggtctatgcgaaccttcatgg
aatatcccagctagtgaaccagaatggttgcctgcttgtttggatcgtgccaataacatg
ttccaacgcgataagaaccacgctagtgttatcatttggtcttgtggtaatgaatcatat
gctggtaaagatattgctgacatggctgattacttccgtagtgttgacaatactcgtcca
gttcactatgaaggtgttgcatggtgtcgtgagtttgattacattacagacatcgaaagt
cgtatgtatgcgaaaccagctgatatcgaagaatacctcacaactggtaaactagttgat
ctttcaagcgttagtgataaacactttgcttcaggtaacctaactaacaaacctcaaaaa
ccttatatttcatgtgaatacatgcacacaatgggtaactctggtggtggattgcaactc
tacactgacttagagaaatatccagaataccaaggtggatttatttgggacttcattgac
caagctatttacaaaacacttccaaatggtagcgaattcctatcatatggtggtgactgg
catgatagaccttctgactacgaattttgtggaaatggtatcgtctttgcagatcgtacc
ctaactccaaaacttcaaacagttaaacatctttactctaatattaagattgctgttgat
gaaaaatcagtaactatcaagaatgataatctcttcgaagatctttctgcttatactttc
ctagctagagtttacgaagatggtagaaaagttagtgaaagtgaatatcactttgatgtt
aaaccaggcgaagaagcaacattcccagttaactttgtagtcgaggcttcaaattctgaa
caaatttacgaagttgcttgtgttctgagggaagcaactgaatgggctcctaaaggtcat
gaaattgttcgtggtcaatatgttgttgaaaagattagcactgaaacaccagttaaagca
cctttgaatgttgttgaaggcgacttcaacatcggtattcaaggacaaaacttctcaatc
ttgctttcacgtgcacaaaatactttagtatctgctaagtataatggtgttgaattcatt
gagaaaggtcctaaacttagcttcactcgtgcttacactgacaacgatcgtggtgctgga
tatccattcgaaatggcaggctggaaggttgctggaaactatagtaaagttacagatact
caaattcaaatcgaagacgactctgttaaagtgacttatgttcatgaattgccaggcttg
tctgatgtcgaagttaaggtaacttatcaagttgattacaagggtcgaatctttgttact
gcaaactatgatggtaaagcaggtttgccaaacttccctgaatttggtctagaatttgct
atcggttcacaatttacaaaccttagctattatggatacggtgcagaagaaagctaccgt
gataaacttcctggtgcctatcttggtcgatatgaaacatctgttgaaaagacatttgct
ccatatctaatgccacaagaatctggtaatcactatggtactcgtgaattcacagtatct
gatgataaccataatggtcttaaattcaccgcacttaataaagcattcgaattcagtgct
ttgcgtaacagtactgaacaaattgaaaatgctcgtcaccaatatgagttgcaagaatct
gatgctacatggattaaagttcttgctgctcaaatgggtgtaggtggtgacgacacatgg
ggtgctccagttcatgacgaattcttgcttagctcagcagatagctatcaattaagcttc
atgattgaaccactaaattag

DBGET integrated database retrieval system