KEGG   Streptococcus thermophilus LMD-9: STER_1366Help
Entry
STER_1366         CDS       T00414                                 

Definition
beta-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
ste  Streptococcus thermophilus LMD-9
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ste00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    STER_1366
  Lipid metabolism
   00600 Sphingolipid metabolism
    STER_1366
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    STER_1366
Enzymes [BR:ste01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     STER_1366
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1270875..1273955)
Genome map
AA seq 1026 aa AA seqDB search
MNMTEKIQTYLNDPKIVSVNTVDAHSDHKYFESLEEFSEGEMKLRQSLNGKWKIHYAQNT
NQVLKDFYKTEFDETDLNFINVPGHLELQGFGSPQYVNTQYPWDGKEFLRPPQVPQESNA
VASYVKHFTLNDALKDKKVFISFQGVATSIFVWVNGNFVGYSEDSFTPSEFEISDYLVEG
DNKLAVAVYRYSTASWLEDQDFWRLYGIFRDVYLYAIPKVHVQDLFVKGDYDYQTKAGQL
DIDLKTVGDYEDKKIKYVLSDYEGIVTEGDASVNGDGELSVSLENLKIKPWSAESPKLYD
LILHVLDDDQVVEVVPVKVGFRRFEIKDKLMLLNGKRIVFKGVNRHEFNARTGRCITEED
MLWDIKVMKQHNINAVRTSHYPNQTRWYELCDEYGLYVIDEANLETHGTWQKLGLCEPSW
NIPASEPEWLPACLDRANNMFQRDKNHASVIIWSCGNESYAGKDIADMADYFRSVDNTRP
VHYEGVAWCREFDYITDIESRMYAKPADIEEYLTTGKLVDLSSVSDKHFASGNLTNKPQK
PYISCEYMHTMGNSGGGLQLYTDLEKYPEYQGGFIWDFIDQAIYKTLPNGSEFLSYGGDW
HDRPSDYEFCGNGIVFADRTLTPKLQTVKHLYSNIKIAVDEKSVTIKNDNLFEDLSAYTF
LARVYEDGRKVSESEYHFDVKPGEEATFPVNFVVEASNSEQIYEVACVLREATEWAPKGH
EIVRGQYVVEKISTETPVKAPLNVVEGDFNIGIQGQNFSILLSRAQNTLVSAKYNGVEFI
EKGPKLSFTRAYTDNDRGAGYPFEMAGWKVAGNYSKVTDTQIQIEDDSVKVTYVHELPGL
SDVEVKVTYQVDYKGRIFVTANYDGKAGLPNFPEFGLEFAIGSQFTNLSYYGYGAEESYR
DKLPGAYLGRYETSVEKTFAPYLMPQESGNHYGTREFTVSDDNHNGLKFTALNKAFEFSA
LRNSTEQIENARHQYELQESDATWIKVLAAQMGVGGDDTWGAPVHDEFLLSSADSYQLSF
MIEPLN
NT seq 3081 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgactgaaaaaattcaaacttatttaaacgatccaaagattgttagcgttaat
actgttgatgctcactcagatcataagtattttgaatctcttgaagaattttctgaaggg
gagatgaagttaagacaatctcttaatggaaaatggaaaattcactatgctcagaataca
aatcaggttttaaaagacttttataaaacagaatttgatgaaactgatttgaatttcatc
aatgtaccaggtcatttagagcttcaaggttttggttctccacaatatgtgaatacccaa
tatccttgggatggtaaagaattccttcgtccacctcaagttcctcaagaatcaaatgct
gttgcatcatacgttaaacattttaccttgaatgatgcattaaaagataaaaaagtattt
atctcattccaaggggttgctacttccatctttgtatgggtcaatggtaacttcgtagga
tacagtgaagattcatttacacctagtgaatttgaaattagtgattaccttgttgaaggt
gataacaagttggcggtagctgtttatcgttattctacagcaagctggttggaagaccaa
gacttctggagactttacggtatttttagagatgtttacttgtatgctattccaaaagtt
cacgttcaagatctctttgttaagggagattatgattaccaaacaaaagcaggtcaattg
gatattgatttgaagactgttggtgattatgaagacaagaagattaaatatgttctttca
gattatgaaggcatcgttacagaaggtgatgcatctgttaatggtgacggtgaactatct
gtaagtcttgaaaatcttaaaatcaaaccttggagtgctgaaagtcctaaactttacgat
ttgatccttcatgttttggatgatgaccaagttgttgaagtcgttccagttaaagttgga
tttagacgctttgaaattaaagataaacttatgcttttgaatggtaagagaattgtcttt
aaaggggttaacagacacgaatttaacgctagaacaggacgttgtatcactgaagaagat
atgctttgggatatcaaagtgatgaaacaacataacatcaatgctgttcgtacttcacac
tatcctaaccaaacacgttggtatgaattgtgtgatgaatatggactttatgttatcgat
gaagccaaccttgaaacacacggtacatggcaaaaacttggtctatgcgaaccttcatgg
aatatcccagctagtgaaccagaatggttgcctgcttgtttggatcgtgccaataacatg
ttccaacgcgataagaaccacgctagtgttatcatttggtcttgtggtaatgaatcatat
gctggtaaagatattgctgacatggctgattacttccgtagtgttgacaatactcgtcca
gttcactatgaaggtgttgcatggtgtcgtgagtttgattacattacagacatcgaaagt
cgtatgtatgcgaaaccagctgatatcgaagaatacctcacaactggtaaactagttgat
ctttcaagcgttagtgataaacactttgcttcaggtaacctaactaacaaacctcaaaaa
ccttatatttcatgtgaatacatgcacacaatgggtaactctggtggtggattgcaactc
tacactgacttagagaaatatccagaataccaaggtggatttatttgggacttcattgac
caagctatttacaaaacacttccaaatggtagcgaattcctatcatatggtggtgactgg
catgatagaccttctgactacgaattttgtggaaatggtatcgtctttgcagatcgtacc
ctaactccaaaacttcaaacagttaaacatctttactctaatattaagattgctgttgat
gaaaaatcagtaactatcaagaatgataatctcttcgaagatctttctgcttatactttc
ctagctagagtttacgaagatggtagaaaagttagtgaaagtgaatatcactttgatgtt
aaaccaggcgaagaagcaacattcccagttaactttgtagtcgaggcttcaaattctgaa
caaatttacgaagttgcttgtgttctgagggaagcaactgaatgggctcctaaaggtcat
gaaattgttcgtggtcaatatgttgttgaaaagattagcactgaaacaccagttaaagca
cctttgaatgttgttgaaggcgacttcaacatcggtattcaaggacaaaacttctcaatc
ttgctttcacgtgcacaaaatactttagtatctgctaagtataatggtgttgaattcatt
gagaaaggtcctaaacttagcttcactcgtgcttacactgacaacgatcgtggtgctgga
tatccattcgaaatggcaggctggaaggttgctggaaactatagtaaagttacagatact
caaattcaaatcgaagacgactctgttaaagtgacttatgttcatgaattgccaggcttg
tctgatgtcgaagttaaggtaacttatcaagttgattacaagggtcgaatctttgttact
gcaaactatgatggtaaagcaggtttgccaaacttccctgaatttggtctagaatttgct
atcggttcacaatttacaaaccttagctattatggatacggtgcagaagaaagctaccgt
gataaacttcctggtgcctatcttggtcgatatgaaacatctgttgaaaagacatttgct
ccatatctaatgccacaagaatctggtaatcactatggtactcgtgaattcacagtatct
gatgataaccataatggtcttaaattcaccgcacttaataaagcattcgaattcagtgct
ttgcgtaacagtactgaacaaattgaaaatgctcgtcaccaatatgagttgcaagaatct
gatgctacatggattaaagttcttgctgctcaaatgggtgtaggtggtgacgacacatgg
ggtgctccagttcatgacgaattcttgcttagctcagcagatagctatcaattaagcttc
atgattgaaccactaaattag

DBGET integrated database retrieval system