KEGG   Streptococcus thermophilus LMD-9: STER_1549Help
Entry
STER_1549         CDS       T00414                                 

Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ste  Streptococcus thermophilus LMD-9
Pathway
ste00260  Glycine, serine and threonine metabolism
ste00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ste01100  Metabolic pathways
ste01110  Biosynthesis of secondary metabolites
ste01130  Biosynthesis of antibiotics
ste01230  Biosynthesis of amino acids
Module
ste_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ste00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    STER_1549
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    STER_1549
Enzymes [BR:ste01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     STER_1549
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABJ66701
JGI: STER1549
UniProt: Q03JC1
Position
complement(1452615..1453823)
Genome map
AA seq 402 aa AA seqDB search
MTYQQPDAKGFYGKFGGQFVPETLMTAVIELDKAYREAKEDSSFQAELDDLLKNYVGRET
PLYHAKRLTDHIGGAQIYLKREDLNHTGAHKINNALGQVLLAKRMGKKKIIAETGAGQHG
VATATAAALFDMDCTIYMGEEDVKRQALNVFRMELLGAKVFSVTDGSRVLKDAVNAALRA
WVAGIDDTHYIMGSALGPAPFPEIVRDFQSVIGREVKRQYAEISGGKLPDAVMACIGGGS
NAIGMFYPFVNDKSVAMYGAEASGLGLDTEKHAATFAKGRPGILHGALMDVLQDAHGQIM
EAFSISAGLDYPGVGPEHCYFNEIGRATYDSITDEEALEGFKLLSRLEGIIPALESSHAI
ALAQKVAAKMSPDQSLIVCLSGRGDKDVMQVKERFEAEAEGK
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgacatatcaacaacctgatgcaaaaggattttacggaaaattcggcggtcagttcgtt
cccgaaacgctgatgacagccgttattgaattggataaggcctatcgtgaagccaaagaa
gattcaagtttccaagcggaattggatgacctccttaaaaactatgttggccgtgaaaca
cctctttaccacgccaaacgtttgacagatcatatcggtggagcgcaaatttaccttaaa
cgtgaagaccttaaccacacaggggcccacaagattaacaatgccctcggtcaagtcttg
cttgctaaacgtatgggtaagaagaaaatcatcgccgaaactggtgcaggtcaacacggt
gtcgcaacagcgacagccgctgctcttttcgacatggactgtaccatctatatgggtgag
gaagatgtgaaacgtcaggcgcttaacgttttccgtatggagttgcttggtgccaaggta
tttagtgttacagatggttcgcgcgtgcttaaggacgctgtaaatgctgctcttcgtgct
tgggtagcaggtattgatgacactcactacatcatgggatctgcccttggtcctgcacca
ttcccagaaattgttcgtgactttcaatctgtcatcggtcgtgaagtcaaacgtcaatat
gcagaaatttcaggcggtaaattgcctgatgctgtaatggcttgtatcggtggtggttca
aatgctatcggtatgttctacccatttgttaatgataaatcagtagccatgtatggtgct
gaggcttctggtttggggcttgatactgaaaaacacgccgcaacctttgccaaaggtcgt
ccaggtatccttcatggagcccttatggatgtcctccaagatgctcatggtcaaatcatg
gaagccttctctatctcagctggtctggactacccaggagttggtcctgagcactgttat
ttcaacgaaattggacgtgcgacttacgactctatcacagatgaagaagctctcgaaggt
ttcaaacttctgtcacgtttagaaggtattatcccagctcttgagtctagccatgccatt
gcgcttgcacaaaaagtggcagctaagatgtcgccagaccaaagcctcatcgtctgcctc
tcaggtcgtggggataaggacgttatgcaggttaaagaacgttttgaagctgaagcagaa
gggaaataa

DBGET integrated database retrieval system