KEGG   Streptococcus thermophilus LMD-9: STER_1742Help
Entry
STER_1742         CDS       T00414                                 

Definition
exonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ste  Streptococcus thermophilus LMD-9
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ste03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1630189..1632693
Genome map
AA seq 834 aa AA seqDB search
MQEFYFSGTIERIIFENASNFFRILLLEIDETDSDFEDYEIIVTGTMGEVMEGEDYTFWG
QLTNHPKYGKQLQMTRYERSKPSASGLIKYFSSDNFKGIGKKTAERIVEIYGEDPIDKIL
EDPSKLEQIPNLSKVNREAFLAKLKINYGTEQILSKLSSYGLTPKAAAQIFNQYKEESLN
LIEKYPYLLVEEVQGIGFKMADQLAERLGIASDAPERLRAALIHCLLEASMEEGDTYIEA
KSLLERTIILLESSRQIELDPALVAHQLTNLIQEDKVQNIETKIFDNTLYFAEQGIYTHL
TRITKDQPDISAEDKIQASLERVEDELGITYDKVQKDAIIKALQSKVFILTGGPGTGKTT
VINGIIKTYADLHGLDLKKSDLPIILAAPTGRAARRMNELTKLPSATIHRHLGLNGEDDF
KTLDDYLDCDLIIIDEFSMVDTWLANQLFESISDTTQVIIVGDQDQLPSVGPGQVLADLL
QIDDLPKVSLTKIFRQSEDSTIVTLASQIRQGQLPTDFTEKKADRSYFEANANHIPQMVP
KIVSAAIKSGIAAQDVQILAPMYRGQAGINNLNTIMQDLLNPKEKANQFAFNDIFFRKND
KILHLVNDTELNVFNGDIGIITDLIPGKYTESKQDEIYMSFDGNEVIYPRNEWNKITLAY
AMSIHKSQGSEFPVVILPITRQSGRMLQRNLIYTAITRAKSKLVMLGEIAAFDYAVHNEG
AKRNTYLIQRFEQTYTQAVDKSVEKNVKNEGTDAFNQTKTENNRPSETLENKDFSENINP
SQTLINTYSHPVDKSVNKPVQTEENYRLTEENWATIDPMIGLSEDDIAAFFNNN
NT seq 2505 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaattttatttttcaggaactatcgagcgcatcatttttgaaaatgccagtaat
ttttttcgtatcctactcttagaaattgatgaaactgacagtgattttgaagactatgaa
atcattgttactggaactatgggggaagtcatggagggggaagactataccttctggggt
cagctaaccaatcaccccaaatatggcaaacaactccaaatgactcgctacgagcgttca
aaaccctctgccagtggccttatcaaatatttctccagtgataatttcaaaggaatcggt
aagaaaacggccgagcgtattgtcgagatttatggcgaagaccctattgacaagattctc
gaagaccctagtaaattagagcagattcctaatctgtccaaggtaaaccgagaagccttc
cttgcaaaattaaaaatcaactatggtactgaacaaatcttgtcaaaactttccagctat
ggactcacaccaaaggctgccgcacaaattttcaaccaatataaggaagaatcacttaac
cttatcgaaaaatatccttatctcttggtagaggaagtccagggaattggatttaaaatg
gccgatcaactagccgaacgcctagggattgctagcgatgctcctgagcgtttacgagcc
gccctaattcactgtctgctagaagctagtatggaagaaggggacacctacatcgaagcc
aagtccttgcttgaacggactatcattcttttggaaagttctcgccagattgaacttgac
cctgccttggttgctcaccaattgaccaacctcatccaagaggataaggtgcaaaatata
gagactaaaatttttgataataccctatattttgcagaacagggcatctatacccaccta
actcgtatcacgaaagaccagcctgacatcagtgctgaggacaaaatccaagcaagtctt
gaaagggtggaagatgagcttggtatcacctatgacaaggttcaaaaagatgccattatt
aaagccctacaaagcaaggtcttcatcctgacaggtggtcccggaacaggaaaaaccact
gttattaacggaattattaaaacctatgctgaccttcatggtttagacctcaaaaagtct
gatttacccattattttagcagcgccaacgggacgggctgctcgtcggatgaacgaactg
accaagcttcctagtgccactatccatagacatttggggcttaatggcgaggacgatttc
aagaccttagatgactatcttgattgcgatttgattatcatcgatgagttctctatggtt
gatacttggttggccaatcaactcttcgaaagcatttccgatactactcaagtaatcatt
gtaggtgaccaagatcagctaccttctgtaggccctggccaagtcttagctgaccttttg
cagattgatgacttgcctaaggtttccctaaccaaaattttcagacaatctgaggattcc
actattgttaccttagctagccagatacgccaaggccaactacccactgatttcacagag
aaaaaagctgaccgatcatactttgaggctaatgctaaccatattccacagatggtccct
aaaattgtctctgctgctattaaaagtgggatcgctgctcaggatgtacagattctggcc
cccatgtaccggggacaggctggtatcaacaatctcaataccattatgcaggatctactt
aatcccaaagaaaaagccaatcaatttgcctttaatgatattttcttccgtaagaatgac
aagattctccacctggtcaacgatacagaactcaatgtcttcaatggcgatatcggaatc
attactgatctcatacctggtaaatatactgaaagtaagcaagatgaaatttacatgtcc
ttcgatggcaatgaggttatctatcctcgtaacgaatggaataagattactctggcctat
gccatgtctatacacaaatcccaagggagtgaattcccagtcgttatccttcccatcaca
cgccaaagtgggcgtatgcttcaacgtaacctcatctacaccgctatcacacgcgccaag
agtaaactggtcatgttgggggaaatcgcagccttcgattatgccgttcacaacgagggg
gccaaacgtaatacctacctcatccaacgttttgaacaaacttatacacaagctgttgat
aagtctgtcgaaaagaatgttaaaaacgagggaacagacgccttcaatcaaacaaaaacg
gaaaacaatagaccctcagaaacccttgaaaacaaagacttctcggaaaatatcaatcca
tcccaaactcttattaacacttattcacatcctgtggataagtctgttaacaaacctgtg
caaacagaagaaaactatcgtttaactgaagaaaattgggcaactatcgacccaatgata
ggtctcagcgaagacgatattgcagccttttttaacaacaactag

DBGET integrated database retrieval system