KEGG   Streptococcus thermophilus LMD-9: STER_1810Help
Entry
STER_1810         CDS       T00414                                 

Definition
UDP-glucose pyrophosphorylase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ste  Streptococcus thermophilus LMD-9
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ste00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    STER_1810
   00052 Galactose metabolism
    STER_1810
   00500 Starch and sucrose metabolism
    STER_1810
   00520 Amino sugar and nucleotide sugar metabolism
    STER_1810
Enzymes [BR:ste01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     STER_1810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1691077..1691991
Genome map
AA seq 304 aa AA seqDB search
MKNQKVRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEDILVVTG
KSKRSIEDHFDSNFELEYNLEQKGKTNLLKLVNDTTSMNLHFIRQSHPRGLGDAVLQAKA
FVGNEPFVVMLGDDLMDITNDKAVPLTKQLINDYEETHASTIAVMPVSSEEVSAYGVIAP
QGKGENGRYSVETFVEKPNPEDAPSNLAIIGRYLLTPEIFGILENQEPGAGNEVQLTDAI
DTLNKTQRVFARVFTGDRYDVGDKFGFMKTSIDYALKHPQIKDDLKQYLIELGHKLEGKP
TKKG
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatcaaaaagttagaaaagctatcatccccgctgcaggactcggaacacgcttt
ttacccgctactaaagcattggccaaagaaatgttgccaatcgttgacaaaccaaccatc
caatttatcgttgaagaagctcttaagtctggtattgaagatatcttggttgttaccggt
aaatcaaaacgctctatcgaagaccattttgactcaaacttcgaattagaatataacttg
gaacaaaaaggtaagactaacttgttgaaattggttaatgacaccacttctatgaatctc
cactttatccgtcaaagtcacccacgtggtctcggagatgctgttctccaagccaaagca
tttgtcggaaatgaaccttttgttgtcatgcttggtgacgacctcatggatattactaac
gacaaagcggtacctttgactaaacaacttatcaacgattatgaggagacacatgcatct
actattgcggttatgcctgtgtcttctgaagaagtctctgcttatggtgtaatcgctcct
cagggtaaaggcgaaaatggacgttacagcgttgaaactttcgttgaaaaaccaaatcca
gaagatgcaccgagtaatcttgctatcatcggacgttaccttttaacacctgagattttc
ggtatcttagaaaatcaagaaccaggtgctgggaatgaagtccaattgactgatgctatc
gatactcttaacaaaacacaacgcgtctttgctcgtgtatttacaggagatcgttatgat
gtcggtgacaaatttggctttatgaagacgtctattgattacgcacttaaacaccctcaa
attaaagatgaccttaagcaataccttattgaattgggccacaaacttgaaggcaaaccc
actaaaaaaggctaa

DBGET integrated database retrieval system